KEGG   Homo sapiens (human): 116028Help
Entry
116028            CDS       T01001                                 

Gene name
RMI2, BLAP18, C16orf75
Definition
(RefSeq) RecQ mediated genome instability 2
  KO
K15365  
RecQ-mediated genome instability protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Module
Bloom's syndrome complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    116028 (RMI2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     116028 (RMI2)
   FA (Fanconi anemia) pathway
     116028 (RMI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96E14(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.13
AA seq 147 aa AA seqDB search
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWM
QGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAV
KMTDLSDNPIHESMWELEVEDLHRNIP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcggactcgttctcaggcggccccgcgggggtgcggcttccgaggtcg
ccgccactcaaggtgctggcggagcagctgcggcgcgacgcggagggcggcccgggcgcg
tggcggctgtcacgggcggcggcgggccgcgggccgctggacctggcggccgtgtggatg
cagggcagggtagtgatggcggaccgcggcgaggctcggctgagggacccgagcggggac
ttctcggtccgcggcctggagcgggtgccgcgcgggcggccctgtctagtcccaggaaag
tatgtgatggtgatgggagtggttcaggcctgcagccctgagccctgcctgcaggctgtg
aagatgacagacctttctgataatcccatccatgaaagtatgtgggaactggaggtagaa
gatttacacaggaatattccttag

DBGET integrated database retrieval system