KEGG   Homo sapiens (human): 116138Help
Entry
116138            CDS       T01001                                 

Gene name
KLHDC3, PEAS, dJ20C7.3
Definition
(RefSeq) kelch domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_6 Kelch_2 Kelch_1 Kelch_5 Kelch_4 Kelch_3
Motif
Other DBs
NCBI-GeneID: 116138
NCBI-ProteinID: NP_476502
OMIM: 611248
HGNC: 20704
Ensembl: ENSG00000124702
Vega: OTTHUMG00000014714
Pharos: Q9BQ90(Tdark)
UniProt: Q9BQ90
Position
6p21.1
AA seq 382 aa AA seqDB search
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLP
PVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRV
SGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWR
DFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRR
SHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVG
DKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDI
RWELNAMTTNSNISRPIVSSHG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttacggtggacagtgcacctggagggcgggccccgcagggtgaaccatgctgcagtg
gctgtcgggcatcgggtatactccttcgggggttactgctctggtgaagactatgagaca
ctgcgtcagatagatgtgcacattttcaatgcagtgtccttgcgttggacaaagctgccc
ccggtgaagtctgccatccgtgggcaagctcctgtggtaccctacatgcgctatggacac
tcaaccgtcctcatcgacgacacagtcctcctttggggcgggcggaatgacaccgaaggg
gcctgcaatgtgctctatgcctttgacgtcaatacgcacaagtggttcacaccccgagtg
tcagggacagttcctggggcccgggatggacattcagcctgtgtcctaggcaagatcatg
tacatttttgggggctacgagcagcaggcggactgtttttccaatgacattcacaagcta
gataccagcaccatgacatggactcttatctgtacaaagggcagccctgcacgctggagg
gacttccactcagccacaatgctgggaagtcacatgtatgtctttgggggccgtgccgac
cgctttgggccattccattccaacaatgagatttactgcaaccgcattcgagtctttgac
accagaactgaggcttggctggactgtcccccgactccagtgctgcctgaggggcgccgg
agccactcggcctttggctacaatggggagctgtacatctttggtggttataatgcaagg
ctgaaccggcacttccatgacctctggaagtttaatcctgtgtcctttacctggaaaaag
attgaaccgaaggggaaggggccatgtccccgccggcgccagtgctgctgtattgttggt
gacaagattgtcctctttgggggtaccagtccatctcctgaggaaggcctgggagatgaa
tttgaccttatagatcattctgacttacacattttggactttagccctagtctgaagact
ctgtgcaaactggccgtgattcagtataacctagaccagtcctgtttgcctcatgatatc
aggtgggagctgaatgccatgaccaccaacagcaatatcagtcgccccatcgtctcctcc
catgggtag

DBGET integrated database retrieval system