KEGG   Homo sapiens (human): 116285Help
Entry
116285            CDS       T01001                                 

Gene name
ACSM1, BUCS1, MACS1
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 1
  KO
K01896  
medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    116285 (ACSM1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  butyrate---CoA ligase
     116285 (ACSM1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   116285 (ACSM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q08AH1(Tbio)
UniProt: 
Position
16p12.3
AA seq 577 aa AA seqDB search
MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWA
QKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQGDHLALMLPR
VPEWWLVAVGCMRTGIIFIPATILLKAKDILYRLQLSKAKGIVTIDALASEVDSIASQCP
SLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSH
GLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHHLPQFDTK
VIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
LLLYENYGQSETGLICATYWGMKIKPGFMGKATPPYDVQVIDDKGSILPPNTEGNIGIRI
KPVRPVSLFMCYEGDPEKTAKVECGDFYNTGDRGKMDEEGYICFLGRSDDIINASGYRIG
PAEVESALVEHPAVAESAVVGSPDPIRGEVVKAFIVLTPQFLSHDKDQLTKELQQHVKSV
TAPYKYPRKVEFVSELPKTITGKIERKELRKKETGQM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggctaatgaggttccggaccctctggggcatccacaaatccttccacaacatc
caccctgccccttcacagctgcgctgccggtctttatcagaatttggagccccaagatgg
aatgactatgaagtaccggaggaatttaactttgcaagttatgtactggactactgggct
caaaaggagaaggagggcaagagaggtccaaatccagctttttggtgggtgaatggccaa
ggggatgaagtaaagtggagcttcagagagatgggagacctaacccgccgtgtagccaac
gtcttcacacagacctgtggcctacaacagggagaccatctggccttgatgctgcctcga
gttcctgagtggtggctggtggctgtgggctgcatgcgaacagggatcatcttcattcct
gcgaccatcctgttgaaggccaaagacattctctatcgactacagttgtctaaagccaag
ggcattgtgaccatagatgcccttgcctcagaggtggactccatagcttctcagtgcccc
tctctgaaaaccaagctcctggtgtctgatcacagccgtgaagggtggctggacttccga
tcgctggttaaatcagcatccccagaacacacctgtgttaagtcaaagaccttggaccca
atggtcatcttcttcaccagtgggaccacaggcttccccaagatggcaaaacactcccat
gggttggccttacaaccctccttcccaggaagtaggaaattacggagcctgaagacatct
gatgtctcctggtgcctgtcggactcaggatggattgtggctaccatttggaccctggta
gaaccatggacagcgggttgtacagtctttatccaccatctgccacagtttgacaccaag
gtcatcatacagacattgttgaaataccccattaaccacttttggggggtatcatctata
tatcgaatgattctgcagcaggatttcaccagcatcaggttccctgccctggagcactgc
tatactggcggggaggtcgtgttgcccaaggatcaggaggagtggaaaagacggacgggc
cttctgctctacgagaactatgggcagtcggaaacgggactaatttgtgccacctactgg
ggaatgaagatcaagccgggtttcatggggaaggccactccaccctacgacgtccaggtc
attgatgacaagggcagcatcctgccacctaacacagaaggaaacattggcatcagaatc
aaacctgtcaggcctgtgagcctcttcatgtgctatgagggtgacccagagaagacagct
aaagtggaatgtggggacttctacaacactggggacagaggtaagatggatgaagagggc
tacatttgtttcctggggaggagtgatgacatcattaatgcctctgggtatcgcatcggg
cctgcagaggttgaaagcgctttggtggagcacccagcggtggcggagtcagccgtggtg
ggcagcccagacccgattcgaggggaggtggtgaaggcctttattgtcctgaccccacag
ttcctgtcccatgacaaggatcagctgaccaaggaactgcagcagcatgtcaagtcagtg
acagccccatacaagtacccaaggaaggtggagtttgtctcagagctgccaaaaaccatc
actggcaagattgaacggaaggaacttcggaaaaaggagactggtcagatgtaa

DBGET integrated database retrieval system