KEGG   Homo sapiens (human): 116379Help
Entry
116379            CDS       T01001                                 

Gene name
IL22RA2, CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2, IL-22RA2, ZCYTOR16
Definition
interleukin 22 receptor, alpha 2
Orthology
K05139  
interleukin 22 receptor alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23.3
AA seq 263 aa AA seqDB search
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
FVQYKIMFSCSMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDL
TSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHA
PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVV
AEIYQPMLDRRSQRSEERCVEIP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctaaacattgctttctaggcttcctcatcagtttcttccttactggtgtagca
ggaactcagtcaacgcatgagtctctgaagcctcagagggtacaatttcagtcccgaaat
tttcacaacattttgcaatggcagcctgggagggcacttactggcaacagcagtgtctat
tttgtgcagtacaaaatcatgttctcatgcagcatgaaaagctctcaccagaagccaagt
ggatgctggcagcacatttcttgtaacttcccaggctgcagaacattggctaaatatgga
cagagacaatggaaaaataaagaagactgttggggtactcaagaactctcttgtgacctt
accagtgaaacctcagacatacaggaaccttattacgggagggtgagggcggcctcggct
gggagctactcagaatggagcatgacgccgcggttcactccctggtgggaaacaaaaata
gatcctccagtcatgaatataacccaagtcaatggctctttgttggtaattctccatgct
ccaaatttaccatatagataccaaaaggaaaaaaatgtatctatagaagattactatgaa
ctactataccgagtttttataattaacaattcactagaaaaggagcaaaaggtttatgaa
ggggctcacagagcggttgaaattgaagctctaacaccacactccagctactgtgtagtg
gctgaaatatatcagcccatgttagacagaagaagtcagagaagtgaagagagatgtgtg
gaaattccatga

DBGET integrated database retrieval system