KEGG   Homo sapiens (human): 116443Help
Entry
116443            CDS       T01001                                 

Gene name
GRIN3A, GluN3A, NMDAR-L, NR3A
Definition
glutamate receptor, ionotropic, N-methyl-D-aspartate 3A
Orthology
K05213  
glutamate receptor ionotropic, NMDA 3A
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116443 (GRIN3A)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    116443 (GRIN3A)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    116443 (GRIN3A)
   05031 Amphetamine addiction
    116443 (GRIN3A)
   05033 Nicotine addiction
    116443 (GRIN3A)
   05034 Alcoholism
    116443 (GRIN3A)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   116443 (GRIN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31.1
AA seq 1115 aa AA seqDB search
MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRAPDDSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAE
ALWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPPELRWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSAL
NICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFM
DMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLS
HDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELS
ELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgaggagactgagtttgtggtggctgctgagcagggtctgtctgctgttgccgccgccc
tgcgcactggtgctggccggggtgcccagctcctcctcgcacccgcagccctgccagatc
ctcaagcgcatcgggcacgcggtgagggtgggcgcggtgcacttgcagccctggaccacc
gccccccgcgcggccagccgcgctccggacgacagccgagcaggagcccagagggatgag
ccggagccagggactaggcggtccccggcgccctcgccgggcgcacgctggttggggagc
accctgcatggccgggggccgccgggctcccgtaagcccggggagggcgccagggcggag
gccctgtggccacgggacgccctcctatttgccgtggacaacctgaaccgcgtggaaggg
ctgctaccctacaacctgtctttggaagtagtgatggccatcgaggcaggcctgggcgat
ctgccacttttgcccttctcctcccctagttcgccatggagcagtgaccctttctccttc
ctgcaaagtgtgtgccataccgtggtggtgcaaggggtgtcggcgctgctcgccttcccc
cagagccagggcgaaatgatggagctcgacttggtcagcttagtcctgcacattccagtg
atcagcatcgtgcgccacgagtttccacgggagagtcagaatccccttcacctacaactg
agtttagaaaattcattaagttctgatgctgatgtcactgtctcaatcctgaccatgaac
aactggtacaattttagcttgttgctgtgccaggaagactggaacatcaccgacttcctc
ctccttacccagaataattccaagttccaccttggttctatcatcaacatcaccgctaac
ctcccctccacccaggacctcttgagcttcctacagatccagcttgagagtattaagaac
agcacacccacagtggtgatgtttggctgcgacatggaaagtatccggcggattttcgaa
attacaacccagtttggggtcatgccccctgaacttcgttgggtgctgggagattcccag
aatgtggaggaactgaggacagagggtctgcccttagggctcattgctcatggaaaaaca
acacagtctgtctttgagcactacgtacaagatgctatggagctggtcgcaagagctgta
gccacagccaccatgatccaaccagaacttgctctcattcccagcacgatgaactgcatg
gaggtggaaactacaaatctcacttcaggacaatatttatcaaggtttctagccaatacc
actttcagaggcctcagtggttccatcagagtaaaaggttccaccatcgtcagctcagaa
aacaactttttcatctggaatcttcaacatgaccccatgggaaagccaatgtggacccgc
ttgggcagctggcaggggggaaagattgtcatggactatggaatatggccagagcaggcc
cagagacacaaaacccacttccaacatccaagtaagctacacttgagagtggttaccctg
attgagcatccttttgtcttcacaagggaggtagatgatgaaggcttgtgccctgctggc
caactctgtctagaccccatgactaatgactcttccacattggacagcctttttagcagc
ctccatagcagtaatgatacagtgcccattaaattcaagaagtgctgctatggatattgc
attgatctgctggaaaagatagcagaagacatgaactttgacttcgacctctatattgta
ggggatggaaagtatggagcatggaaaaatgggcactggactgggctagtgggtgatctc
ctgagagggactgcccacatggcagtcacttcctttagcatcaatactgcacggagccag
gtgatagatttcaccagccctttcttctccaccagcttgggcatcttagtgaggacccga
gatacagcagctcccattggagccttcatgtggccactccactggacaatgtggctgggg
atttttgtggctctgcacatcactgccgtcttcctcactctgtatgaatggaagagtcca
tttggtttgactcccaaggggcgaaatagaagtaaagtcttctccttttcttcagccttg
aacatctgttatgccctcttgtttggcagaacagtggccatcaaacctccaaaatgttgg
actggaaggtttctaatgaacctttgggccattttctgtatgttttgcctttccacatac
acggcaaacttggctgctgtcatggtaggtgagaagatctatgaagagctttctggaata
catgaccccaagttacatcatccttcccaaggattccgctttggaactgtccgagaaagc
agtgctgaagattatgtgagacaaagtttcccagagatgcatgaatatatgagaaggtac
aatgttccagccacccctgatggagtggagtatctgaagaatgatccagagaaactagac
gccttcatcatggacaaagcccttctggattatgaagtgtcaatagatgctgactgcaaa
cttctcactgtggggaagccatttgccatagaaggatacggcattggcctcccacccaac
tctccattgaccgccaacatatccgagctaatcagtcaatacaagtcacatgggtttatg
gatatgctccatgacaagtggtacagggtggttccctgtggcaagagaagttttgctgtc
acggagactttgcaaatgggcatcaaacacttctctgggctctttgtgctgctgtgcatt
ggatttggtctgtccattttgaccaccattggtgagcacatagtatacaggctgctgcta
ccacgaatcaaaaacaaatccaagctgcaatactggctccacaccagccagagattacac
agagcaataaatacatcatttatagaggaaaagcagcagcatttcaagaccaaacgtgtg
gaaaagaggtctaatgtgggaccccgtcagcttaccgtatggaatacttccaatctgagt
catgacaaccgacggaaatacatctttagtgatgaggaaggacaaaaccagctgggcatc
cggatccaccaggacatccccctccctccaaggagaagagagctccctgccttgcggacc
accaatgggaaagcagactccctaaatgtatctcggaactcagtgatgcaggaactctca
gagctcgagaagcagattcaggtgatccgtcaggagctgcagctggctgtgagcaggaaa
acggagctggaggagtatcaaaggacaagtcggacttgtgagtcctag

DBGET integrated database retrieval system