KEGG   Homo sapiens (human): 116444Help
Entry
116444            CDS       T01001                                 

Gene name
GRIN3B, GluN3B, NR3B
Definition
glutamate receptor, ionotropic, N-methyl-D-aspartate 3B
Orthology
K05214  
glutamate receptor ionotropic, NMDA 3B
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    116444 (GRIN3B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116444 (GRIN3B)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    116444 (GRIN3B)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    116444 (GRIN3B)
   05031 Amphetamine addiction
    116444 (GRIN3B)
   05033 Nicotine addiction
    116444 (GRIN3B)
   05034 Alcoholism
    116444 (GRIN3B)
Ion channels [BR:hsa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), NMDA
   116444 (GRIN3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 1043 aa AA seqDB search
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARA
ALAPRLPHNLSLELVVAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGC
DIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVV
TLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYC
IDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRH
SAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGP
VWLCSYGRPPAARPTGAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPR
RLLQARAAPAEAPPHSGRPGSQE
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtgcgggcgctgtggctgggcctggcgctggcgctggggccggggtccgcg
gggggccaccctcagccgtgcggcgtcctggcgcgcctcgggggctccgtgcgcctgggc
gccctcctgccccgcgcgcctctcgcccgcgcccgcgcccgcgccgccctggcccgggcc
gccctggcgccgcggctgccgcacaacctgagcttggagctggtggtcgccgcgcccccc
gcccgcgaccccgcctcgctgacccgcggcctgtgccaggcgctggtgcctccgggcgtg
gcggccctgctcgcctttcccgaggctcggcccgagctgctgcagctgcacttcctggcg
gcggccaccgagacccccgtgctcagcctgctgcggcgggaggcgcgcgcgcccctcgga
gccccgaacccattccacctgcagctgcactgggccagccccctggagacgctgctggat
gtgctggtggcggtgctgcaggcgcacgcctgggaagacgtcggcctggccctgtgccgc
actcaggaccccggcggcctggtggccctctggacaagccgggctggccggcccccacag
ctggtcctggacctaagccggcgggacacgggagatgcaggactgcgggcacgcctggcc
ccgatggcggcgccagtggggggtgaagcaccggtacccgcggcggtcctcctcggctgt
gacatcgcccgtgcccgtcgggtgctggaggccgtacctcccggcccccactggctgttg
gggacaccactgccgcccaaggccctgcccaccgcggggctgccaccagggctgctggcg
ctgggcgaggtggcacgacccccgctggaggccgccatccatgacattgtgcaactggtg
gcccgggcgctgggcagtgcggcccaggtgcagccgaagcgagccctcctccccgccccg
gtcaactgcggggacctgcagccggccgggcccgagtccccggggcgcttcttggcacgg
ttcctggccaacacgtccttccagggccgcacgggccccgtgtgggtgacaggcagctcc
caggtacacatgtctcggcactttaaggtgtggagccttcgccgggacccacggggcgcc
ccggcctgggccacggtgggcagctggcgggacggccagctggacttggaaccgggaggt
gcctctgcacggcccccgcccccacagggtgcccaggtctggcccaagctgcgtgtggta
acgctgttggaacacccatttgtgtttgcccgtgatccagacgaagacgggcagtgccca
gcggggcagctgtgcctggaccctggcaccaacgactcggccaccctggacgcactgttc
gccgcgctggccaacggctcagcgccccgtgccctgcgcaagtgctgctacggctactgc
attgacctgctggagcggctggcggaggacacgcccttcgacttcgagctgtacctcgtg
ggtgacggcaagtacggcgccctgcgggacggccgctggaccggcctggtcggggacctg
ctggccggccgggcccacatggcggtcaccagcttcagtatcaactccgcccgctcacag
gtggtggacttcaccagccccttcttctccaccagcctgggcatcatggtgcgggcacgg
gacacggcctcacccatcggtgcctttatgtggcccctgcactggtccacgtggctgggc
gtctttgcggccctgcacctcaccgcgctcttcctcaccgtgtacgagtggcgtagcccc
tacggcctcacgccacgtggccgcaaccgcagcaccgtcttctcctactcctcagccctc
aacctgtgctacgccatcctcttcagacgcaccgtgtccagcaagacgcccaagtgcccc
acgggccgcctgctcatgaacctctgggccatcttctgcctgctggtgctgtccagctac
acggccaacctggctgccgtcatggtcggggacaagaccttcgaggagctgtcggggatc
cacgaccccaagctgcaccacccggcgcagggcttccgcttcggcaccgtgtgggagagc
agcgccgaggcgtacatcaagaagagcttccccgacatgcacgcacacatgcggcgccac
agcgcgcccaccacgccccgcggcgtcgccatgctcacgagcgacccccccaagctcaac
gccttcatcatggacaagtcgctcctggactacgaggtctccatcgacgccgactgcaaa
ctgctgaccgtgggaaagcccttcgccattgagggctatgggatcggactgccccagaac
tcgccgctcacctccaacctgtccgagttcatcagccgctacaagtcctccggcttcatc
gacctgctccacgacaagtggtacaagatggtgccttgcggcaagcgggtctttgcggtt
acagagaccctgcagatgagcatctaccacttcgcgggcctcttcgtgttgctgtgcctg
ggcctgggcagcgctctgctcagctcgctgggcgagcacgccttcttccgcctggcgctg
ccgcgcatccgcaaggggagcaggctgcagtactggctgcacaccagccagaaaatccac
cgcgccctcaacacggagccaccagaggggtcgaaggaggagacggcagaggcggagccc
agcggccccgaggtggagcagcagcagcagcagcaggaccagccaacggctccggagggc
tggaaacgggcgcgccgggccgtggacaaggagcgccgcgtgcgcttcctgctggagccc
gccgtggttgtggcacccgaagcggacgcggaggcggaggctgcgccgcgagagggcccc
gtctggctgtgctcctacggccgcccgcccgccgcaaggcccacgggggccccccagccc
ggggagctgcaggagctggagcgccgcatcgaagtcgcgcgtgagcggctccgccaggcc
ctggtgcggcgcggccagctcctggcacagctcggggacagcgcacgtcaccggcctcgg
cgcttgcttcaggccagagcggcccccgcggaggccccaccacactctggccgaccgggg
agccaggaatga

DBGET integrated database retrieval system