KEGG   Homo sapiens (human): 116969Help
Entry
116969            CDS       T01001                                 

Gene name
ART5, ARTC5
Definition
ADP-ribosyltransferase 5 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     116969 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 291 aa AA seqDB search
MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAH
HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGS
RELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQ
FASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcggctttgatgatcgccctcggcagcctcggcctccacacctggcaggcc
caggctgttcccatcctgcccctgggcctggctccagacacctttgacgatacctatgtg
ggttgtgcagaggagatggaggagaaggcagcccccctgctaaaggaggaaatggcccac
catgccctgctgcgggaatcctgggaggcagcccaggagacctgggaggacaagcgtcga
gggcttaccttgccccctggcttcaaagcccagaatggaatagccattatggtctacacc
aactcatcgaacaccttgtactgggagttgaatcaggccgtgcggacgggcggaggctcc
cgggagctctacatgaggcactttcccttcaaggccctgcatttctacctgatccgggcc
ctgcagctgctgcgaggcagtgggggctgcagcaggggacctggggaggtggtgttccga
ggtgtgggcagccttcgctttgaacccaagaggctgggagactctgtccgcttgggccag
tttgcctccagctccctggataaggcagtggcccacagatttggtaatgccaccctcttc
tctctaacaacttgctttggggcccctatacaggccttctctgtctttcccaaggagcgc
gaggtgctgattcccccccatgaagtctttttggttaccagattctctcaggatggagcc
cagagcttggtgactctctggagctataatcagacctgtagccattttaactgcgcctat
ctgggtggggagaagaggcggggctgtgtgtctgcgccaggagccctgggaacgggtgac
cttcatatgacgaagaggcacctccagcagccttga

DBGET integrated database retrieval system