KEGG   Homo sapiens (human): 116986Help
Entry
116986            CDS       T01001                                 

Gene name
AGAP2, CENTG1, GGAP2, PIKE, RP11-571M6.8
Definition
ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Orthology
K17848  
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Endocytosis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14.1
AA seq 1192 aa AA seqDB search
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAAGARGSETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPG
PPLSGGLSPDPKPGGAPTSSRRPLLSSPSWGGPEPEGRAGGGIPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgagccggggcgcgggcgcgcttcagcgccggacaacgacctacctcatctcgctgacc
ctggttaagctcgagtcggtgcctccgccgccgccttctccgtctgcggccgcggccggc
gccgccggtgccagaggctccgagactggggatcctggcagcccccgaggcgcggaggag
ccgggcaagaagcggcacgaacgtctcttccaccggcaggatgcgctgtggatcagcacg
agcagcgcgggcaccgggggcgcggagcccccagccctgtccccggctccggccagtccg
gcccgcccagtctcccccgctcccggccgccgcctctccctctgggccgtccctccggga
cccccgctctccgggggactgagccccgaccccaagcctgggggcgcccccacctcctcc
cggcgccccctgctcagcagcccgagctggggcggcccggagcccgaaggccgggcgggc
ggcggcatccctggctcatcctctccgcaccctggcaccggcagccggaggctcaaggtg
gcgcctcctccgccggctcccaagccttgcaagaccgtgaccacgagtggagccaaagcc
ggcgggggcaagggcgcgggtagccgcctgtcatggcccgaaagcgagggcaagcccagg
gtcaaggggtcaaagagcagcgccgggactggagcttcggtctctgccgccgccaccgcc
gccgccgccgggggagggggctctacagcttcgacctctggtggggtcggggctggggct
ggagcccgagggaagttgtcccctcggaaaggcaagagtaagaccttggacaacagtgac
ttgcatccgggaccgcctgccggctctcctcctccgctaaccctcccaccaactccgagt
ccagccactgctgtcaccgctgcttccgcgcagccccccgggcctgcacctccaatcact
ctggagcctccagctccggggctgaaacggggccgggaggggggccgagcatccactcgt
gaccgcaagatgctcaagtttatcagcggcatcttcaccaagagcacaggagggcctcct
ggctccgggccccttcccggaccccccagcctgtcttctggcagcgggtccagggagctg
ctgggcgccgagctccgcgcttcccctaaggctgtgatcaatagccaggaatggactttg
agccgctccattcctgaactgcgcctgggtgtgctgggcgatgccaggagtgggaagtca
tcgctcatccaccgattcctgactggctcataccaggtgctggagaagacagagagtgag
cagtacaagaaagaaatgttggtggatggacagacacatctggtgctaatccgagaggaa
gctggggcacctgatgccaagttctcaggctgggcagatgctgtgatcttcgtcttcagc
ctggaggatgagaacagtttccaggctgtgagccgtctccatgggcagctgagttccctt
cgcggggagggacgaggaggcctggccttggcactggtggggacacaagacaggatcagt
gcttcctcccctcgggtggtgggagatgctcgtgccagagctctgtgcgcggacatgaaa
cgctgcagctactatgagacttgtgcaacctatgggctcaatgtggatcgggtcttccag
gaggtggcccagaaggtggtgaccttgcgcaagcagcaacagcttctggctgcctgcaag
tccctgcccagctccccaagccactcagctgcatccactccggtagctggccaggctagt
aacgggggccacactagcgactactcttcttccctcccgtcctcaccgaatgttggtcac
cgggagctccgagccgaggcagctgcagtggctggattgagcaccccagggtccctgcac
cgggcagccaagcgcaggaccagcctttttgcgaatcgtcggggtagtgactccgagaaa
cgaagcttggatagtcggggagagacaacagggagtgggcgagccatccccatcaaacag
agcttcctactaaaacgaagtggcaattccttgaacaaagaatggaagaagaaatatgta
accctgtccagtaatggctttctactctaccaccccagtattaacgattacatccacagt
acccacggcaaggagatggacttgctgcgaacaacagtcaaagtcccgggcaagcggccc
ccgagggccatctctgcctttggcccctcagccagcattaacgggctcgtcaaggacatg
agcactgtccagatgggtgaaggcctggaagccactactcccatgccaagccctagcccc
agccccagttccctgcagccaccaccagatcagacatccaaacacctgctgaagccagac
cggaatttggcccgagccctcagcacggactgtaccccatctggagacctgagccccctg
agtcgggaaccccctccttctcccatggtgaagaagcagaggaggaaaaaattgacaaca
ccatccaagactgaaggctcggctgggcaggctgaagccaagcgcaaaatgtggaaacta
aaatcctttggtagtttaagaaatatttataaagcagaggaaaactttgagttcctgatc
gtgtccagcacgggtcagacgtggcactttgaggcagccagttttgaggagcgggatgcc
tgggtccaggccatcgagagtcagatcctagccagtctgcaatgctgtgagagcagcaag
gtcaagctgcgcacagacagccaaagcgaggccgtggccatccaggcgatccggaacgcc
aaggggaattcaatctgcgtggactgcggggcccccaaccccacgtgggccagcttgaac
ctgggcgccctcatctgcatcgagtgttctggcatccaccgcaacctgggcacacacctg
tcccgcgttcgctcgctggacttggacgactggccacgggagctgaccctggtgctgacg
gctattggcaacgacacggccaaccgcgtgtgggaaagcgacacgcgaggccgtgccaag
ccctcgcgggactcttcgcgggaggagcgcgagtcgtggattcgcgccaagtacgagcag
ctactgttcctggcgccgctgagcacctcggaggagccgctgggccgccagctgtgggcc
gccgtgcaggcccaggacgtggctaccgttctcctgcttttggcccatgcgcgacacggg
ccgctcgacaccagcgtagaggacccacagctgcgctccccactccacctggcggccgag
ctcgcccacgtcgtcatcacgcaactgctgctgtggtacggcgcggacgtggcggcccgt
gacgcccagggccgcacggcgctgttctacgcccgccaggctggaagccagctgtgcgcc
gacatccttctccagcacggctgcccgggtgagggcggcagcgcggccaccacgcccagc
gcggccaccacgcccagcatcaccgccacgcccagcccccgccgccggagcagcgccgct
agcgtgggccgcgccgacgccccggttgcgctggtatag

DBGET integrated database retrieval system