KEGG   Homo sapiens (human): 116987Help
Entry
116987            CDS       T01001                                 

Gene name
AGAP1, AGAP-1, CENTG2, GGAP1, cnt-g2
Definition
ArfGAP with GTPase domain, ankyrin repeat and PH domain 1
Orthology
K12491  
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 857 aa AA seqDB search
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQ
WSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKA
DGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNK
SRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSR
VRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTREEKERWIRAKYEQKL
FLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKG
NVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS
RRNNNRNNSSGRVPTII
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagcagcagctggccaactcggctgccatccgggccgagatccagcgcttc
gagtcggtccaccccaacatctactccatctacgagctgctggagcgcgtggaggagccg
gtgctgcagaaccagatccgggagcacgtcatcgccatcgaagatgccttcgtgaacagc
caggaatggacgctgagtcgatctgtcccggagctcaaagtgggaattgtgggtaacttg
gccagcggcaagtctgccctggtgcaccggtacctgacgggcacatatgtccaggaggag
tctccggaaggtggcaggttcaagaaagagattgtcgttgatggacagagctatctgctg
ctgatcagagatgaagggggccccccggaggcgcagtttgccatgtgggtggacgctgtt
atatttgtcttcagcttggaggatgaaataagtttccagaccgtttaccactactacagt
cgaatggccaactatcggaacacgagcgagattcctctggttctggtgggaacccaggat
gccataagttctgctaacccgagggtcatcgatgacgccagggcgaggaagctctccaac
gacctgaaacggtgcacgtactacgagacgtgtgctacatacgggctgaatgtggagagg
gtcttccaggacgttgcccagaagattgttgccacaaggaagaagcagcagctgtccata
ggaccctgcaagtcgctacctaattctcccagccattcctccgtctgttccgcgcaggtg
tctgccgtgcacatcagccagacaagtaatggaggtgggagtttaagcgactattcctcc
tccgttccatcgactcccagcaccagccagaaggaacttcggatcgatgttcctcccact
gccaacacgcccacgcccgttcgcaagcagtctaagcgccggtccaacctgttcacctct
cggaaagggagcgacccagacaaagagaagaaaggcctggagagtcgtgcggacagcatt
gggagcggccgagccatcccaattaaacagggcatgctgttgaagcgaagtggcaaatcg
ttgaataaagagtggaaaaagaaatatgtcaccctgtgtgacaatggcgtgctgacctat
catcccagtttacatgattacatgcagaatgttcatggtaaggagattgaccttctgaga
accactgtgaaagtcccagggaagaggccaccccgagccacgtcagcctgcgcacccatc
tccagccctaaaaccaatggcctatccaaggacatgagcagtttacacatctcacccaat
tcagggaatgtcactagtgcatctgggtctcagatggcaagcggcatcagcctggtctcc
ttcaacagccgacccgacggcatgcaccagcgctcctactcagtctccagtgccgaccag
tggagtgaggctacggtcattgcaaactcggccatcagcagtgacacagggctgggtgac
tccgtatgctccagccccagtatctccagcaccaccagccccaagctcgacccgcccccc
tcccctcacgccaacagaaagaagcaccgaaggaagaaaagcactagcaacttcaaagcc
gacggcctgtccggcactgctgaagaacaagaagaaaattttgagtttatcattgtgtcc
ctcactggccaaacatggcactttgaagccacgacgtatgaggagcgggacgcctgggtc
caagccatcgagagccagatcctggccagcctgcagtcgtgcgagagcagcaagaacaag
tcccggctgacgagccagagcgaggccatggccctgcagtcgatccggaacatgcgcggg
aactcccactgtgtggactgcgagacccagaatcccaactgggccagtttgaacttggga
gccctcatgtgcatcgaatgctcagggatccaccggaatcttggcacccacctttcccga
gtccgatctctggacctggatgactggccagtcgagctcatcaaggtgatgtcatccatc
gggaacgagctagccaacagcgtctgggaagagagcagccaggggcggacgaaaccatcg
gtagactccacaagggaagagaaggaacggtggatccgtgccaagtacgagcagaagctc
ttcctggccccgctgccctgcacggagctgtccctgggccagcacctgctgcgggccacc
gccgacgaggacctgcggacggccatcctgctgctggcacacggctcccgggacgaggtg
aacgagacctgcggggagggagacggccgcacggcgctgcatctggcctgccgcaagggg
aatgtggtcctggcgcagctcctgatctggtacggagtggacgtcacggcccgagatgcc
cacgggaacacagctctggcctacgcccggcaggcctccagccaggagtgcatcgacgtg
ctgctgcagtacggctgccccgacgagcgcttcgtgctcatggccacccctaacctgtcc
aggagaaacaataaccggaacaacagcagtgggagggtgcccaccatcatctga

DBGET integrated database retrieval system