KEGG   Homo sapiens (human): 117Help
Entry
117               CDS       T01001                                 

Gene name
ADCYAP1R1, PAC1, PAC1R, PACAPR, PACAPRI
Definition
(RefSeq) ADCYAP receptor type I
  KO
K04587  
pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Insulin secretion
Renin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    117 (ADCYAP1R1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117 (ADCYAP1R1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    117 (ADCYAP1R1)
   04924 Renin secretion
    117 (ADCYAP1R1)
  Environmental adaptation
   04713 Circadian entrainment
    117 (ADCYAP1R1)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Hypothalamic hormone
   Pituitary adenyl cyclase-activating peptide (PACAP)
    117 (ADCYAP1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P41586(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 468 aa AA seqDB search
MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDN
ITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
DGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMN
DSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIP
LFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtcgtgcacgtttccctggctgctctcctcctgctgcctatggcccctgcc
atgcattctgactgcatcttcaagaaggagcaagccatgtgcctggagaagatccagagg
gccaatgagctgatgggcttcaatgattcctctccaggctgtcctgggatgtgggacaac
atcacgtgttggaagcccgcccatgtgggtgagatggtcctggtcagctgccctgagctc
ttccgaatcttcaacccagaccaagtctgggagaccgaaaccattggagagtctgatttt
ggtgacagtaactccttagatctctcagacatgggagtggtgagccggaactgcacggag
gatggctggtcggaacccttccctcattactttgatgcctgtgggtttgatgaatatgaa
tctgagactggggaccaggattattactacctgtcagtgaaggccctctacacggttggc
tacagcacatccctcgtcaccctcaccactgccatggtcatcctttgtcgcttccggaag
ctgcactgcacacgcaacttcatccacatgaacctgtttgtgtcgttcatgctgagggcg
atctccgtcttcatcaaagactggattctgtatgcggagcaggacagcaaccactgcttc
atctccactgtggaatgtaaggccgtcatggttttcttccactactgtgttgtgtccaac
tacttctggctgttcatcgagggcctgtacctcttcactctgctggtggagaccttcttc
cctgaaaggagatacttctactggtacaccatcattggctgggggaccccaactgtgtgt
gtgacagtgtgggctacgctgagactctactttgatgacacaggctgctgggatatgaat
gacagcacagctctgtggtgggtgatcaaaggccctgtggttggctctatcatggttaac
tttgtgctttttattggcattatcgtcatccttgtgcagaaacttcagtctccagacatg
ggaggcaatgagtccagcatctacttgcgactggcccggtccaccctgctgctcatccca
ctattcggaatccactacacagtatttgccttctccccagagaatgtcagcaaaagggaa
agactcgtgtttgagctggggctgggctccttccagggctttgtggtggctgttctctac
tgttttctgaatggtgaggtacaagcggagatcaagcgaaaatggcgaagctggaaggtg
aaccgttacttcgctgtggacttcaagcaccgacacccgtctctggccagcagtggggtg
aatgggggcacccagctctccatcctgagcaagagcagctcccaaatccgcatgtctggc
ctccctgctgacaatctggccacctga

DBGET integrated database retrieval system