KEGG   Homo sapiens (human): 117144Help
Entry
117144            CDS       T01001                                 

Gene name
CATSPER1, CATSPER, SPGF7
Definition
cation channel, sperm associated 1
Orthology
K16889  
cation channel sperm-associated protein 1
Organism
hsa  Homo sapiens (human)
Disease
H01282  
Spermatogenic failure
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.1
AA seq 780 aa AA seqDB search
MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHP
PEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQ
RDGRRHHDGSQYGGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYL
PHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKS
PHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYH
QHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSA
HSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTN
LFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFVVCLNTVMLVAQTFAEVEIRGEWYF
MALDSIFFCIYVVEALLKIIALGLSYFFDFWNNLDFFIMAMAVLDFLLMQTHSFAIYHQS
LFRILKVFKSLRALRAIRVLRRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAV
LRALFRKSDPKRFQNIFTTIFTLFTLLTLDDWSLIYMDSRAQGAWYIIPILVIYIIIQYF
IFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLEDSLTELRAAEPKEVASEGTML
KRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAVIDEIVDTTFEAGEEDFRN
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaactcagtgcctgaaaaggctcagaatgaggcagacaccaataacgcagat
aggttctttcgctctcactcatcacccccacaccacaggccaggccacagcagagctctc
caccattacgagttgcaccatcacggcgtgccccaccaacgtggtgaatctcaccaccct
ccggagttccaagacttccacgaccaagccttgtcctcccatgtccaccaatctcaccac
cacagcgaggcacggaatcacggcagagcccatggccccacaggctttggtctggctccc
tctcaaggcgccgtcccctcccaccgttcctacggtgaggactaccatgatgagctccaa
cgtgatggcaggaggcatcatgatgggtcccaatacggtgggttccatcagcagagtgac
tcccattaccatagggggtctcaccatggcagaccccaatatctcggtgagaatttatcc
cactattcctctggcgtgccccaccacggtgaggcttcccaccatggtgggtcctacctc
ccccatggacccaatccctacagtgagtccttccaccacagcgaggcttcccaccttagc
gggctccaacacgatgagtcccagcatcaccaagtcccccaccgtggctggccccaccat
caccaagtccaccaccatggcaggtcccgtcatcatgaagcccaccagcatggaaagtct
cctcatcacggagagaccatttcccctcattcctctgtggggtcctaccagcgtgggata
tctgactatcacagcgagtaccaccaaggtgatcaccaccccagtgagtaccaccatggc
gaccatccccaccacacacagcaccactaccaccagacccaccggcaccgagactaccat
cagcaccaagaccaccacggcgcgtatcattccagttacctccatggcgactacgtccag
agcacttcccaactctctatcccacacacatcccggagcctgattcacgatgcccccggc
cctgctgcttctcgtacaggagtcttcccctatcacgtagcacacccacggggctcggct
cacagcatgactcggtcctccagcacaatccgctcacgtgtcacccagatgtccaaaaaa
gtccatacccaggatatctccaccaaacattcagaagactggggcaaagaagaagggcaa
tttcagaaacgcaaaaccggccggctccagcggacccgcaagaagggacactctaccaat
ctcttccagtggctgtgggaaaagctaaccttcctcattcagggcttccgggaaatgatc
cggaacctgacccaatccttggcctttgaaactttcatcttcttcgttgtctgcctcaac
accgtcatgctggtggcccagaccttcgctgaagtcgagatccggggcgagtggtacttc
atggccttggactccatattcttctgcatctacgtggtggaagccctgctcaagatcatc
gccctgggcctctcgtacttctttgacttctggaacaatttggacttcttcattatggcc
atggccgtgctggacttcttgctgatgcagacccactccttcgccatctaccaccaaagc
ctcttccggatcctcaaggtcttcaagagcctgcgggccctgagggcaatccgggtcctg
cggaggctcagcttcctgaccagcgtccaggaagtgacagggaccctgggccagtccttg
ccgtccatcgcagccatcctcatcctcatgtttacctgcctcttcctcttctccgcggtc
ctccgggcactgttccgcaaatctgaccccaagcgcttccagaacatcttcaccaccatc
ttcaccctcttcaccttgctcacgctggatgactggtccctcatctacatggacagccgt
gcccagggcgcctggtacatcattcccatcctcgtaatttacatcatcatccagtacttc
atcttcctcaacctggtgattactgtcctggtggatagcttccagacggcgctgttcaaa
ggccttgagaaagcgaagcaggagagggccgcccggatccaagagaagctgctggaagac
tcactgacggagctcagagctgcagagcccaaagaggtggcgagtgaaggcaccatgctg
aagcggctcatcgagaaaaagtttgggaccatgactgagaagcagcaggagctcctgttc
cattacctgcagctggtggcaagcgtggagcaggagcagcagaagttccgctcccaggca
gccgtcatcgatgagattgtggacaccacatttgaggctggagaagaggacttcaggaat
tga

DBGET integrated database retrieval system