KEGG   Homo sapiens (human): 117155Help
Entry
117155            CDS       T01001                                 

Gene name
CATSPER2
Definition
(RefSeq) cation channel sperm associated 2
  KO
K16890  
cation channel sperm-associated protein 2
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  CatSper and two-pore channel
   117155 (CATSPER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15.3
AA seq 530 aa AA seqDB search
MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGD
QHQLVRFSIKPQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLFKNFIIFLVFL
NTIILMVEIELLESTNTKLWPLKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVF
DFVVTMLSLLPEVVVLVGVTGQSVWLQLLRICRVLRSLKLLAQFRQIQIIILVLVRALKS
MTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFFSDLPNSLVTVFILFTLDHWY
ALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKELNEEMARREV
QLKADMFKRQIIQRRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE
EDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLPG
LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttaccaacaagaagagcagatgcagcttccccgagctgatgccattcgttca
cgtctcatcgatactttctctctcattgagcatttgcaaggcttgagccaagctgtgccg
cggcacactatcagggagttacttgatccttcccgccagaagaaacttgtattgggagat
caacaccagctagtgcgtttctctataaagcctcagcgtatagaacagatttcacatgcc
cagaggctgttgagcaggcttcatgtgcgctgcagtcagaggccacctctttctttgtgg
gccggatgggtccttgagtgtcctctcttcaaaaacttcatcatcttcctggtctttttg
aatacgatcatattgatggttgaaatagaattgctggaatccacaaataccaaactatgg
ccattgaagctgaccttggaggtggcagcttggtttatcttgcttattttcatcctggag
atccttcttaagtggctatccaacttttctgttttctggaagagtgcctggaatgtcttt
gactttgttgttaccatgttgtccctgcttcccgaggttgtggtattggtaggggtaaca
ggccaatcggtgtggcttcagcttctgaggatctgccgggtgctgaggtctctcaaactc
cttgcacaattccgtcaaattcaaattattattttggtcctggtcagggccctcaagagc
atgaccttcctcttgatgttgctgctcatcttcttctacatttttgctgtgactggtgtc
tacgtcttctcagagtacacccgttcacctcgtcaggacctggagtaccatgtgttcttc
tcggacctcccgaattccctggtaacagtgttcattctcttcaccttggatcattggtat
gcactgcttcaggacgtctggaaggtgcctgaagtcagtcgcatcttcagcagcatctat
ttcatcctttggttgttgcttggctccattatctttcgaagtatcatagtagccatgatg
gttactaactttcagaatatcaggaaagagctgaatgaggagatggcgcgtcgggaggtt
cagctcaaagctgacatgttcaagcggcagatcatccagaggagaaaaaacatgtcacat
gaagcactgacgtcaagccatagcaaaatagaggacagttcaagaggagctagtcaacaa
agggaaagtttggacttatcagaagtgtctgaagtagagtctaattatggtgccactgaa
gaggatttaataacatctgcatcaaaaacagaagagaccttgtcaaaaaagagagagtac
cagtcttcctcctgtgtctcctccacatcctcttcctattcttcctcttctgaatccaga
ttttctgaatctattggtcgtttggactgggagactcttgtgcacgaaaatctgcccggg
ctaatggaaatggatcaggatgaccgtgtttggcccagagactcactcttccgatatttt
gagttgctagaaaagcttcagtataacctagaggaacgtaagaagttacaagagtttgca
gtgcaggcactgatgaacttggaagacaagtaa

DBGET integrated database retrieval system