KEGG   Homo sapiens (human): 117195Help
Entry
117195            CDS       T01001                                 

Gene name
MRGPRX3, GPCR, MRGX3, SNSR1, SNSR2
Definition
(RefSeq) MAS related GPR family member X3
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Mas proto-oncogene & Mas-related (MRGs)
    117195 (MRGPRX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srbc TcpE
Motif
Other DBs
NCBI-GeneID: 117195
NCBI-ProteinID: NP_473372
OMIM: 607229
HGNC: 17980
Ensembl: ENSG00000179826
Vega: OTTHUMG00000166435
Pharos: Q96LB0(Tdark)
UniProt: Q96LB0
Position
11p15.1
AA seq 322 aa AA seqDB search
MDSTIPVLGTELTPINGREETPCYKQTLSFTGLTCIVSLVALTGNAVVLWLLGCRMRRNA
VSIYILNLVAADFLFLSGHIICSPLRLINIRHPISKILSPVMTFPYFIGLSMLSAISTER
CLSILWPIWYHCRRPRYLSSVMCVLLWALSLLRSILEWMFCDFLFSGANSVWCETSDFIT
IAWLVFLCVVLCGSSLVLLVRILCGSRKMPLTRLYVTILLTVLVFLLCGLPFGIQWALFS
RIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPE
VDEGGGWLPQETLELSGSRLEQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaccatcccagtcttgggtacagaactgacaccaatcaacggacgtgaggag
actccttgctacaagcagaccctgagcttcacggggctgacgtgcatcgtttcccttgtc
gcgctgacaggaaacgcggttgtgctctggctcctgggctgccgcatgcgcaggaacgct
gtctccatctacatcctcaacctggtcgcggccgacttcctcttccttagcggccacatt
atatgttcgccgttacgcctcatcaatatccgccatcccatctccaaaatcctcagtcct
gtgatgacctttccctactttataggcctaagcatgctgagcgccatcagcaccgagcgc
tgcctgtccatcctgtggcccatctggtaccactgccgccgccccagatacctgtcatca
gtcatgtgtgtcctgctctgggccctgtccctgctgcggagtatcctggagtggatgttc
tgtgacttcctgtttagtggtgctaattctgtttggtgtgaaacgtcagatttcattaca
atcgcgtggctggtttttttatgtgtggttctctgtgggtccagcctggtcctgctggtc
aggattctctgtggatcccggaagatgccgctgaccaggctgtacgtgaccatcctcctc
acagtgctggtcttcctcctctgtggcctgccctttggcattcagtgggccctgttttcc
aggatccacctggattggaaagtcttattttgtcatgtgcatctagtttccattttcctg
tccgctcttaacagcagtgccaaccccatcatttacttcttcgtgggctcctttaggcag
cgtcaaaataggcagaacctgaagctggttctccagagggctctgcaggacacgcctgag
gtggatgaaggtggagggtggcttcctcaggaaaccctggagctgtcgggaagcagattg
gagcagtga

DBGET integrated database retrieval system