KEGG   Homo sapiens (human): 117246Help
Entry
117246            CDS       T01001                                 

Gene name
FTSJ3, EPCS3, SPB1
Definition
(RefSeq) FtsJ homolog 3 (E. coli) (EC:2.1.1.-)
  KO
K14857  
AdoMet-dependent rRNA methyltransferase SPB1 [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     117246 (FTSJ3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    117246 (FTSJ3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q23.3
AA seq 847 aa AA seqDB search
MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQ
VAAKFMPVSSLIVGVDLVPIKPLPNVVTLQQDITTERCRQALRKELKTWKVDVVLNDGAP
NVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWIFQQLFRRVQA
TKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAKTVTELVTKKKPKAEG
YAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVL
GRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDEEDSTAGTTKQPSKEEE
EEEEEEQLNQTLAEMKAQEVAELKRKKKKLLREQRKQRERVELKMDLPGVSIADEGETGM
FSLSTIRGHQLLEEVTQGDMSAADTFLSDLPRDDIYVSDVEDDGDDTSLDSDLDPEELAG
VRGHQGLRDQKRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIED
DADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSG
TEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKH
RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVG
KKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVA
QLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQ
KKKHKRK
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagggcaaagttggcaagagccgacgagacaagttttatcacttggcgaag
gagacgggttaccgttcccgatctgctttcaagctgatccagctcaatcgccgctttcag
ttcctgcagaaagcccgagccttgctggacctgtgtgctgcgccagggggatggctgcag
gtagctgccaagtttatgcctgtatccagccttattgtgggagtggacctggttccaatc
aagcctctccccaatgtggtgactctccagcaggacatcacaacagaacgttgtaggcag
gccctgaggaaggagctgaagacctggaaggttgatgttgtgctcaatgatggggccccc
aacgttggggctagctgggtccatgatgcttactcacaagcccatttgacactgatggct
ctacgtttggcttgtgactttttggcccgtggtggcagcttcatcacaaaggttttccgt
tctcgtgactatcagcctctgctatggatctttcagcagctgttccgccgtgtccaggcc
accaagccccaagcctctcgccatgaatctgcagagatctttgtagtctgccaaggattc
ctggcccctgacaaggttgacagtaaattctttgaccccaaatttgcctttaaggaggtt
gaagttcaggctaagaccgttactgaattggttactaagaagaagccaaaggctgaaggc
tatgctgagggtgacctcactctctatcaccgtacctcagtcactgacttcctccgagct
gccaaccctgttgacttcctctccaaggccagcgaaatcatggtagatgatgaagagttg
gcacagcatccagctaccactgaggacatacgggtgtgctgtcaggacatcagagtgttg
gggcgcaaggagctcaggtcgctactaaactggagaacaaaacttcggcgatatgtggcc
aagaagctgaaagaacaagcaaaggcactggacatcagcctcagctctggagaggaagat
gaaggtgatgaggaggactcaacagctggaaccacaaagcagccctctaaggaggaggag
gaagaggaggaggaggaacaactgaaccagaccttggcagaaatgaaggcccaggaggtg
gcggaattgaagaggaagaaaaagaagctgttgcgtgagcagagaaagcagcgggagcgt
gtggagctgaagatggatctgcctggggtttccattgcagacgagggggagactggcatg
ttctccttgagcaccatccggggtcaccagttattagaggaagtaacacaaggggatatg
agtgcagcagacacatttctgtccgatctgccaagggatgatatctatgtgtcagatgtt
gaggacgacggtgatgacacatctctggatagtgacctggatccagaggagctggcagga
gtcaggggacatcagggtctaagggaccaaaagcgtatgcgacttactgaagtgcaagat
gataaagaggaggaggaggaggagaatccactgctggtaccactggaggaaaaggcagta
ctgcaggaagaacaagccaacctgtggttctcaaagggcagctttgctgggatcgaggac
gatgccgatgaggccctggagatcagtcaggcccagctgttatttgagaaccggcggaag
ggacggcagcagcagcagaagcagcagctgccacagacacccccttcctgtttgaagact
gagataatgtctcccctgtaccaagatgaagcccctaagggaacagaggcttcttcgggg
acagaagctgccactggccttgaaggggaagaaaaggatggcatctcagacagtgatagc
agtactagcagtgaggaagaagagagctgggaacccctccgtggtaagaagcgaagccgt
gggcctaagtcagatgatgacgggtttgagatagtgcctattgaggacccagcgaaacat
cggatactggaccccgaaggccttgctctaggtgctgttattgcctcttccaaaaaggcc
aagagagacctcatagataactccttcaaccggtacacatttaatgaggatgagggggag
cttccggagtggtttgtgcaagaggaaaagcagcaccggatacgacagttgcctgttggt
aagaaggaggtggagcattaccggaaacgctggcgggaaatcaatgcacgtcccatcaag
aaggtggctgaggctaaggctagaaagaaaaggaggatgctgaagaggctggagcagacc
aggaagaaggcagaagccgtggtgaacacagtggacatctcagaacgagagaaagtggca
cagctgcgaagtctctacaagaaggctgggcttggcaaggagaaacgccatgtcacctac
gttgtagccaaaaaaggtgtgggccgcaaagtgcgccggccagctggagtcagaggtcat
ttcaaggtggtggactcaaggatgaagaaggaccaaagagcacagcaacgtaaggaacaa
aagaaaaaacacaaacggaagtaa

DBGET integrated database retrieval system