KEGG   Homo sapiens (human): 117583Help
Entry
117583            CDS       T01001                                 

Gene name
PARD3B, ALS2CR19, PAR3B, PAR3L, PAR3beta
Definition
(RefSeq) par-3 family cell polarity regulator beta
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.3
AA seq 1205 aa AA seqDB search
MKVTVCFGRTGIVVPCKEGQLRVGELTQQALQRYLKTREKGPGYWVKIHHLEYTDGGILD
PDDVLADVVEDKDKLIAVFEEQEPLHKIESPSGNPADRQSPDAFETEVAAQLAAFKPIGG
EIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVL
NGVQTELLTSPRTKDTLSDMTRTVEISGEGGPLGIHVVPFFSSLSGRILGLFIRGIEDNS
RSKREGLFHENECIVKINNVDLVDKTFAQAQDVFRQAMKSPSVLLHVLPPQNREQYEKSV
IGSLNIFGNNDGVLKTKVPPPVHGKSGLKTANLTGTDSPETDASASLQQNKSPRVPRLGG
KPSSPSLSPLMGFGSNKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGA
AIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKG
EPDCCALSLETSEQLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFK
DGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA
ECGAFSKPCFENCQNAVTTSRRNDNSILHPLGTCSPQDKQKGLLLPNDGWAESEVPPSPT
PHSALGLGLEDYSHSSGVDSAVYFPDQHINFRSVTPARQPESINLKASKSMDLVPDESKV
HSLAGQKSESPSKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPHMVRGRGCNES
FRAAIDKSYDGPEEIEADGLSDKSSHSGQGALNCESAPQGNSELEDMENKARKVKKTKEK
EKKKEKGKLKVKEKKRKEENEDPERKIKKKGFGAMLRFGKKKEDKGGKAEQKGTLKHGGL
REEELEKMKEERERIGAKHQELREKQARGLLDYATGAIGSVYDMDDDEMDPNYARVNHFR
EPCTSANVFRSPSPPRAGPFGYPRDGHPLSPERDHLEGLYAKVNKPYHPLVPADSGRPTG
GSTDRIQKLRKEYYQARREGFPLYEDDEGRARPSEYDLLWVPGRGPDGNAHNLRFEGMER
QYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYP
QHYPPPPAPQHKGPFRQDVPPSPPQHQRMPAYQETGRPGPRGGSPDQYPYRTQDSRQKNP
MTAAV
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcggcaggacgggcatcgtggtgccctgcaaggagggccag
ctgcgcgtcggcgagctcacccagcaggcgctgcagcggtacctgaagacccgggagaag
ggtcctggttactgggtgaagattcatcacttagaatatacagatggaggaatcctggat
ccagatgatgtcttggcagatgttgttgaagataaagacaagctgattgctgtgtttgaa
gaacaagaaccactccacaagattgagagccccagtggaaaccctgcagatcggcagagc
ccagatgcttttgagacagaagtggccgcccaactggccgcatttaagccaattggtggg
gagattgaagtaaccccttctgctctaaaactaggcactccactgctggtgaggagaagc
agtgacccagtgccaggcccacctgctgatacccagccaagcgcttcacaccctggtggc
cagagtctgaaactggttgttccagattccacgcagaacttggaagacagagaagttttg
aatggtgtacagacagaactactaacttcgccaagaactaaggacacattgagtgatatg
acaagaacagtggagatttctggggaaggaggcccattgggaatacatgtagtgcccttc
ttttcatctctgagtggaaggattctaggactcttcatccgaggcattgaagacaacagc
aggtccaagcgggagggactatttcacgaaaatgaatgtattgtaaaaatcaacaatgtg
gatctcgtagacaaaacctttgctcaggctcaagatgtcttccgccaggcaatgaaatct
ccaagtgtgctcctccacgtgcttcctccacaaaaccgtgaacagtatgaaaagtcagtc
attggctctcttaacatttttggtaataatgatggcgttttgaaaaccaaagtgccgcct
cctgtccatggaaaatcgggactaaagacagcaaatctcacaggaaccgatagtcctgaa
acagatgcatcagcttccctgcaacaaaacaagagtccccgagtaccaaggctgggagga
aaaccatcctctccctcactctcgcctctcatgggatttggcagcaataaaaatgcaaag
aaaattaagattgacctaaagaaaggccctgaaggacttggtttcactgtggttaccaga
gactcttccatacatggtcccggtcccatttttgtaaaaaacattttaccaaagggagca
gcaataaaagatggccgcctacaatcaggggacagaattttggaggtaaatgggagagat
gtcaccggacgaacccaggaagagcttgtggccatgctcaggagcaccaagcagggggag
acagcatcgctggtcattgcccgccaagaaggacattttctgccccgagagttgaaagga
gaacctgactgctgtgcactctctctggagacaagcgagcagctcacctttgagatcccc
ctgaatgattcaggttctgctggcctcggggtgagcttaaaagggaacaaatccagagaa
actggaacagacttggggatttttatcaaatccatcattcatggaggcgctgcttttaag
gatggtcgtctgcgaatgaatgaccagctgattgcagttaatggggaatctcttttggga
aagtccaaccacgaagctatggaaacacttaggcggtcaatgtccatggagggaaacatc
cgagggatgatccagttggtgattctgaggaggccagagagaccaatggaggatcctgca
gagtgtggggcattttccaagccatgctttgagaactgtcaaaatgctgtaaccacctct
aggcgaaatgataatagtatcctgcatccacttggcacttgcagtccacaagacaaacag
aaaggtctattgctgcccaatgacggatgggccgagagtgaagttccaccttctccaaca
ccacattctgctctgggattgggcctcgaagattacagccacagctctggggtggattca
gcagtatattttccagatcagcacatcaacttcagatctgtgacaccggccaggcagcct
gaatcaattaatttgaaagcctcgaagagcatggaccttgtgccagatgaaagcaaggtt
cactcattggctggacaaaaatcggaatctccaagcaaagattttggtccaactctgggt
ttgaaaaagtccagctccttggagagtctgcagactgcagtggccgaggtcaggaagaat
gaccttccctttcacaggccccggccgcacatggttcgaggccgaggctgcaatgagagc
tttagagcagccattgacaaatcctacgatggacctgaagaaatagaagctgacggtctg
tctgataagagctctcactctggccaaggagctctgaattgtgagtctgcccctcagggg
aattcggagctagaggacatggaaaataaagccaggaaagtcaaaaaaacgaaagagaag
gagaagaaaaaggaaaagggcaaattgaaagtcaaggagaaaaagcgcaaagaggagaat
gaagatccagaaaggaaaataaagaagaagggcttcggcgccatgctgagatttggaaag
aagaaagaggataagggtggaaaggctgagcagaaaggtactctgaaacatggtggcctg
agagaagaagagctggagaaaatgaaagaagagcgtgaaaggattggagcaaaacatcag
gagctaagggaaaagcaggcaagaggtcttcttgattatgctactggtgcaattggatca
gtgtatgatatggatgatgatgaaatggaccccaattatgccagagtgaaccactttcgg
gaaccatgcacatcagcaaatgtctttagatctccatctccccctcgagctggaccattt
ggttaccctcgggatggccatccactgtctccagaaagagaccacttagagggtctctat
gccaaggtcaacaagccataccatccactggttccagctgacagtggccgtcctacgggt
ggaagcactgaccgtatccagaagttgcggaaagagtattatcaggctcggagggaaggt
ttccctttatatgaagacgacgaaggaagagcaaggccatctgagtatgacctactctgg
gtgcctggaaggggtccagatgggaatgcacacaacctccgctttgaagggatggagagg
cagtacgcatccttacccaggggaggacccgcagatcctgtagactatctgccagcagca
cctcgggggctctacaaggaaagggagcttccctattatccaggggctcatcctatgcac
cctcccaaagggagctatccccgccccacagagctcagggtggcagatctccggtatcct
cagcactacccacccccgccagctccccagcacaaaggaccctttcgacaagacgttccg
ccttcccctccccagcaccaaagaatgccagcctatcaggaaacaggcagaccagggccc
cgtgggggcagcccagaccagtacccttaccgaacccaggattcccggcagaagaacccc
atgactgcagccgtatag

DBGET integrated database retrieval system