KEGG   Homo sapiens (human): 1178Help
Entry
1178              CDS       T01001                                 

Gene name
CLC, GAL10, Gal-10, LGALS10, LGALS10A, LPPL_HUMAN
Definition
Charcot-Leyden crystal galectin (EC:3.1.1.5)
Orthology
K13334  
eosinophil lysophospholipase (galectin-10) [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     1178 (CLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 142 aa AA seqDB search
MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGR
RVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEA
VKMVQVWRDISLTKFNVSYLKR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctacccgtgccatacacagaggctgcctctttgtctactggttctactgtg
acaatcaaagggcgaccacttgcctgtttcttgaatgaaccatatctgcaggtggatttc
cacactgagatgaaggaggaatcagacattgtcttccatttccaagtgtgctttggtcgt
cgtgtggtcatgaacagccgtgagtatggggcctggaagcagcaggtggaatccaagaat
atgccctttcaggatggccaagaatttgaactgagcatctcagtgctgccagataagtac
caggtaatggtcaatggccaatcctcttacacctttgaccatagaatcaagcctgaggct
gtgaagatggtgcaagtgtggagagatatctccctgaccaaatttaatgtcagctattta
aagagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system