KEGG   Homo sapiens (human): 118Help
Entry
118               CDS       T01001                                 

Gene name
ADD1, ADDA
Definition
(RefSeq) adducin 1
  KO
K18622  
adducin
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     118 (ADD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 737 aa AA seqDB search
MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSM
ILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMS
LGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHF
LIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHI
HTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILR
NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSRSPGSPV
GEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRT
STSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVT
ASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKS
PPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEK
EEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEGAAADPGSDGSPGKSPSKKKK
KFRTPSFLKKSKKKSDS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgattctcgtgctgcggtggtgacctcaccacccccgaccacagcccctcac
aaggagaggtacttcgaccgagtagatgagaacaacccagagtacttgagggagaggaac
atggcaccagaccttcgccaggacttcaacatgatggagcaaaagaagagggtgtccatg
attctgcaaagccctgctttctgtgaagaattggaatcaatgatacaggagcaatttaag
aaggggaagaaccccacaggcctattggcattacagcagattgcagattttatgaccacg
aatgtaccaaatgtctacccagcagctccgcaaggagggatggctgccttaaacatgagt
cttggtatggtgactcctgtgaacgatcttagaggatctgattctattgcgtatgacaaa
ggagagaagttattacggtgtaaattggcagcgttttatagactagcagatctctttggg
tggtctcagcttatctacaatcatatcacaaccagagtgaactccgagcaggaacacttc
ctcattgtcccttttgggcttctttacagtgaagtgactgcatccagtttggttaagatc
aatctacaaggagatatagtagatcgtggaagcactaatctgggagtgaatcaggccggc
ttcaccttacactctgcaatttatgctgcacgcccggacgtgaagtgcgtcgtgcacatt
cacaccccagcaggggctgcggtctctgcaatgaaatgtggcctcttgccaatctccccg
gaggcgctttcccttggagaagtggcttatcatgactaccatggcattctggttgatgaa
gaggaaaaagttttgattcagaaaaatctggggcctaaaagcaaggttcttattctccgg
aaccatgggctcgtgtcagttggagagagcgttgaggaggccttctattacatccataac
cttgtggttgcctgtgagatccaggttcgaactctggccagtgcaggaggaccagacaac
ttagtcctgctgaatcctgagaagtacaaagccaagtcccgttccccagggtctccggta
ggggaaggcactggatcgcctcccaagtggcagattggtgagcaggaatttgaagccctc
atgcggatgctcgataatctgggctacagaactggctacccttatcgataccctgctctg
agagagaagtctaaaaaatacagcgatgtggaggttcctgctagtgtcacaggttactcc
tttgctagtgacggtgattcgggcacttgctccccactcagacacagttttcagaagcag
cagcgggagaagacaagatggctgaactctggccggggcgacgaagcttccgaggaaggg
cagaatggaagcagtcccaagtcgaagactaagtggactaaagaggatggacatagaact
tccacctctgctgtccctaacctgtttgttccattgaacactaacccaaaagaggtccag
gagatgaggaacaagatccgagagcagaatttacaggacattaagacggctggccctcag
tcccaggttttgtgtggtgtagtgatggacaggagcctcgtccagggagagctggtgacg
gcctccaaggccatcattgaaaaggagtaccagccccacgtcattgtgagcaccacgggc
cccaaccccttcaccacactcacagaccgtgagctggaggagtaccgcagggaggtggag
aggaagcagaagggctctgaagagaatctggacgaggctagagaacagaaagaaaagagt
cctccagaccagcctgcggtcccccacccgcctcccagcactcccatcaagctggaggaa
gaccttgtgccggagccgactactggagatgacagtgatgctgccacctttaagccaact
ctccccgatctgtcccctgatgaaccttcagaagcactcggcttcccaatgttagagaag
gaggaggaagcccatagacccccaagccccactgaggcccctactgaggccagccccgag
ccagccccagacccagccccggtggctgaagaggctgccccctcagctgtcgaggagggg
gccgccgcggaccctggcagcgatgggtctccaggcaagtccccgtccaaaaagaagaag
aagttccgtaccccgtcctttctgaagaagagcaagaagaagagtgactcctga

DBGET integrated database retrieval system