KEGG   Homo sapiens (human): 1181Help
Entry
1181              CDS       T01001                                 

Gene name
CLCN2, CIC-2, CLC2, ECA2, ECA3, EGI11, EGI3, EGMA, EJM6, EJM8, LKPAT, clC-2
Definition
chloride channel, voltage-sensitive 2
Orthology
K05011  
chloride channel 2
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Disease
H00808  
Idiopathic generalized epilepsies (IGEs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    1181 (CLCN2)
Ion channels [BR:hsa04040]
 Chloride channels
  CLCN chloride channel
   1181 (CLCN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27.1
AA seq 881 aa AA seqDB search
MAAAAAEEGMEPRALQYEQTLMYGRYTQDLGAFAKEEAARIRLGGPEPWKGPPSSRAAPE
LLEYGRSRCARCRVCSVRCHKFLVSRVGEDWIFLVLLGLLMALVSWVMDYAIAACLQAQQ
WMSRGLNTSILLQYLAWVTYPVVLITFSAGFTQILAPQAVGSGIPEMKTILRGVVLKEYL
TLKTFIAKVIGLTCALGSGMPLGKEGPFVHIASMCAALLSKFLSLFGGIYENESRNTEML
AAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFFAATFSAFIFRVLAVWNRDEE
TITALFKTRFRLDFPFDLQELPAFAVIGIASGFGGALFVYLNRKIVQVMRKQKTINRFLM
RKRLLFPALVTLLISTLTFPPGFGQFMAGQLSQKETLVTLFDNRTWVRQGLVEELEPPST
SQAWNPPRANVFLTLVIFILMKFWMSALATTIPVPCGAFMPVFVIDGIHTDSSTYRIVPG
GYAVVGAAALAGAVTHTVSTAVIVFELTGQIAHILPVMIAVILANAVAQSLQPSLYDSII
RIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHVALSCTFRDLRLALHRTKGRMLALVES
PESMILLGSIERSQVVALLGAQLSPARRRQHMQERRATQTSPLSDQEGPPTPEASVCFQV
NTEDSAFPAARGETHKPLKPALKRGPSVTRNLGESPTGSAESAGIALRSLFCGSPPPEAA
SEKLESCEKRKLKRVRISLASDADLEGEMSPEEILEWEEQQLDEPVNFSDCKIDPAPFQL
VERTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASF
RDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcggcggcggaggaagggatggagccacgggcgctgcagtacgagcagacc
ctgatgtatggccggtacactcaggaccttggggcctttgccaaagaggaagctgctcgg
attcgcctgggagggcctgaaccctggaaaggtcccccttcctctcgggctgccccagag
ctcttggaatatggacggagccgttgcgcccgatgccgcgtctgttctgtccgctgccac
aagttcctagtatccagggttggtgaagattggatcttcctggtcctgctggggcttctc
atggcattggtcagctgggtcatggactatgccattgctgcctgtctgcaagcccagcag
tggatgtcccggggcttgaacaccagcatcttgctccagtacctggcctgggtcacctac
cctgttgtcctcatcactttctcagccggattcacacagatcctggcccctcaggctgtc
ggctctggcatccctgagatgaagaccatcttgcggggagtggtgctgaaagaatacctc
acactcaagacctttatagctaaggtcattgggctgacctgcgccctaggcagcgggatg
ccgcttggcaaagagggcccttttgtgcatatcgcaagcatgtgtgctgcccttctcagc
aagttcctctccctctttgggggtatctatgagaatgaatcccggaacacagagatgctg
gctgccgcctgtgccgtgggggtgggctgctgcttcgcggcacctattggaggcgtcctc
ttcagcatcgaggtcacctccaccttctttgcagtgcggaactactggcggggcttcttc
gctgccaccttcagtgccttcatcttccgggtcttggcagtctggaaccgggatgaagag
actattacagccctcttcaaaacccgattccggctcgacttcccctttgacctgcaggag
ctgccagcctttgctgtcattggtattgctagtggcttcggtggagccctctttgtctac
ctgaaccggaagattgtccaggtgatgcggaagcagaaaaccatcaatcgcttcctcatg
aggaaacgcctgctcttcccggctctggtgaccctgctcatctccacgctgaccttcccc
cctggctttggacagttcatggctggacagctctcacagaaagagacgctggtcaccctg
tttgacaatcggacgtgggtccgccagggcctggtggaggagctagaaccacccagcacc
tcacaggcctggaacccaccacgtgccaacgtcttcctcaccctggtcatcttcattctc
atgaagttctggatgtctgcactggccaccaccatcccagttccctgtggggccttcatg
cctgtctttgtcattgatggaattcatacggacagcagcacctaccggattgtgcctggg
ggctacgctgtggtcggggcagctgcgctggcaggagcggtgacacacacagtgtccacg
gctgtgatcgtgttcgagctcacaggccagattgcccacatcctgcctgtcatgatcgcc
gtcatcctggccaacgctgtcgcccagagtctgcagccctccctctatgacagcatcatc
cgaatcaagaaactgccctacctgcctgagctcggctggggccgccaccagcagtaccgg
gtgcgtgtggaggacatcatggtgcgggatgttccccatgtggccctcagctgcaccttc
cgggacctgcgtttggcactgcacaggaccaagggccgaatgctggccctagtggagtcc
cctgagtccatgattctgctgggctccatcgagcgttcacaggtggtggcattgttgggg
gcccagctgagcccagcccgccggcggcagcacatgcaggagcgcagagccacccagacc
tctccactatctgatcaggagggtccccctacccctgaggcttctgtctgcttccaggtg
aacacagaagactcagccttcccagcagcccggggggagacccacaagcccctaaagcct
gcactcaagagggggcccagtgtcaccaggaacctcggagagagtcccacagggagcgca
gagtcggcaggcatcgccctccggagcctcttctgtggcagtccaccccctgaggctgct
tcggagaagttggaatcctgtgagaagcgcaagctgaagcgtgtccgaatctccctggca
agtgacgcggacctggaaggcgagatgagccctgaagagattctggagtgggaggagcag
caactagatgaacctgtcaacttcagtgactgcaaaattgatcctgctcccttccagctg
gtggagcggacctctttgcacaagactcacactatcttctcactgctgggagtggaccat
gcttatgtcaccagtattggcagactcattggaatcgttactctaaaggagctccggaag
gccatcgagggctctgtcacagcacagggtgtgaaagtccggccgcccctcgccagcttc
cgagacagtgccaccagcagcagtgacacggagaccactgaggtgcatgcactctggggg
ccccactcccgtcatggcctcccccgggagggcagcccttccgacagcgacgacaaatgc
caatga

DBGET integrated database retrieval system