KEGG   Homo sapiens (human): 118429Help
Entry
118429            CDS       T01001                                 

Gene name
ANTXR2, CMG-2, CMG2, HFS, ISH, JHF
Definition
(RefSeq) anthrax toxin receptor 2
  KO
K20909  
anthrax toxin receptor
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Disease
H00614  
Infantile systemic hyalinosis and juvenile hyaline fibromatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    118429 (ANTXR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21.21
AA seq 489 aa AA seqDB search
MVAERSPARSPGSWLFPGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWI
EIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYI
HEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLD
FEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLS
GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGG
KSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIKDPPPPPAPAP
KEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPE
ETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEVCIW
ECIEKELTA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggagcggtccccggcccgcagccccgggagctggctgttccccgggctgtgg
ctgttggtgctcagcggtcccggggggctgctgcgcgcccaggagcagccctcctgcaga
agagcctttgatctctacttcgtcctggacaagtctgggagtgtggcaaataactggatt
gaaatttataatttcgtacagcaacttgcggagagatttgtgagccctgaaatgagatta
tctttcattgtgttttcttctcaagcaactattattttgccattaactggagacagaggc
aaaatcagtaaaggcttggaggatttaaaacgtgttagtccagtaggagagacatatatc
catgaaggactaaagctagcgaatgaacaaattcagaaagcaggaggcttgaaaacctcc
agtatcataattgctctgacagatggcaagttggacggtctggtgccatcatatgcagag
aaagaggcaaagatatccaggtcacttggggctagtgtttattgtgttggtgtccttgat
tttgaacaagcacagcttgaaagaattgctgattccaaggagcaagttttccctgtcaaa
ggtggatttcaggctcttaaaggaataattaattctatactagctcagtcatgtactgaa
atcctagaattgcagccctcaagtgtctgtgtgggggaggaatttcagattgtcttaagt
ggaagaggattcatgctgggcagtcggaatggcagtgttctctgcacttacactgtaaat
gaaacatatacaacgagtgtaaaaccagtaagtgtacagcttaattctatgctttgtcct
gcacctatcctgaataaagctggagaaactcttgatgtttcagtgagctttaatggagga
aaatctgtcatttcaggatcattaattgtcacagccacagaatgttctaacgggatcgca
gccatcattgttattttggtgttactgctactcctggggatcggtttgatgtggtggttt
tggcccctttgctgcaaagtggttattaaggatcctccaccaccacccgcccctgcacca
aaagaggaggaagaagaacctttgcctactaaaaagtggccaactgtggatgcttcctat
tatggtggtcgaggggttggaggaattaaaagaatggaggttcgttggggtgataaagga
tctactgaggaaggtgcaaggctagagaaagccaaaaatgctgtggtgaagattcctgaa
gaaacagaggaacccatcaggcctagaccacctcgacccaaacccacacaccagcctcct
cagacaaaatggtacaccccaattaagggtcgtcttgatgctctctgggctttgttgagg
cggcagtatgaccgggtttctttgatgcgacctcaggaaggagatgaggtttgtatatgg
gaatgtattgagaaagagctaactgcttga

DBGET integrated database retrieval system