KEGG   Homo sapiens (human): 1188Help
Entry
1188              CDS       T01001                                 

Gene name
CLCNKB, CLCKB, ClC-K2, ClC-Kb
Definition
(RefSeq) chloride voltage-gated channel Kb
  KO
K05018  
chloride channel Kb
Organism
hsa  Homo sapiens (human)
Pathway
Collecting duct acid secretion
Disease
H00239  
Bartter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    1188 (CLCNKB)
Ion channels [BR:hsa04040]
 Chloride channels
  CLCN chloride channel
   1188 (CLCNKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 687 aa AA seqDB search
MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWYFLMTLGVLM
ALVSCAMDLAVESVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGG
SGIPEVKTMLAGVVLEDYLDIKNFGAKVVGLSCTLACGSTLFLGKVGPFVHLSVMMAAYL
GRVRTTTIGEPENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVWDYWRGF
FAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGGLCGILGSAYL
FCQRIFFGFIRNNRFSSKLLATSKPVYSALATLVLASITYPPSAGRFLASRLSMKQHLDS
LFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP
MPAGYFMPIFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAVTH
TISTALLAFEVTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKKLPYLPRILGRNI
GSHRVRVEHFMNHSITTLAKDMPLEEVVKVVTSTDVAKYPLVESTESQILVGIVRRAQLV
QALKAEPPSWAPGHQQCLQDILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTS
RGRAVGCVSWVEMKKAISNLTNPPAPK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtttgtggggctgcgtgaaggctcctcagggaaccctgtgactctgcaggag
ctgtggggcccctgtccccgcatccgccgaggcatccgaggtggcctggagtggctgaag
cagaagctcttccgcctgggcgaggactggtacttcctgatgaccctcggggtgctcatg
gccctggtcagctgtgccatggacttggctgttgagagtgtggtccgagcgcaccagtgg
ctgtacagggagattggggacagccacctgctccggtatctctcctggactgtgtaccct
gtggccctcgtctctttctcttcaggcttctctcagagcatcacaccctcctctggaggt
tctggaatcccggaggtgaagaccatgttggcgggtgtggtcttggaggactacctggat
atcaagaactttggggccaaagtggtgggcctctcctgcaccctggcctgtggcagcacc
ctcttcctcgggaaagtgggccctttcgtgcacctgtctgtgatgatggctgcctacctg
ggccgtgtgcgcaccacgaccatcggggagcctgagaacaagagcaagcaaaacgaaatg
ctggtggcagcggcggcagtgggcgtggccacagtctttgcagctcccttcagcggcgtc
ctgttcagcatcgaggtcatgtcttcccacttctctgtctgggattactggaggggcttc
tttgcggccacctgcggggccttcatgttccggctcctggcggtcttcaacagcgagcag
gagaccatcacctccctctacaagaccagtttccgggtggacgttcccttcgacctgcct
gagatcttcttttttgtggcgctggggggtctctgtggcatcctgggcagcgcttacctc
ttctgtcagcgaatcttctttggcttcatcaggaacaataggttcagctccaaactgctg
gccaccagcaagcctgtgtactccgctctggccaccttggttctcgcctccatcacctac
ccacccagcgccggccgcttcctagcttctcggctgtccatgaagcagcatctggactcg
ctgttcgacaaccactcctgggcgctgatgacccagaactccagcccaccctggcccgag
gagctcgacccccagcacctgtggtgggaatggtaccacccgcggttcaccatctttggg
acccttgccttcttcctggttatgaagttctggatgctgattctggccaccaccatcccc
atgcctgccgggtacttcatgcccatctttgtctatggagctgctatcgggcgcctcttt
ggggagactctctcttttatcttccctgagggcatcgtggctggagggatcaccaatccc
atcatgccaggggggtatgctctggcaggggctgcagccttctcaggggctgtgacccac
accatctccacggcgctgctggccttcgaggtgaccggccagatagtgcatgcactgccc
gtgctgatggcggtgctggcagccaacgccattgcacagagctgccagccctccttctat
gatggcaccgtcattgtcaagaagctgccatacctgccacggattctgggccgcaacatc
ggttcccaccgcgtgagggtggagcacttcatgaaccacagcatcaccacactggccaag
gacatgccactggaggaggtggtcaaggttgtgacctccacagacgtggccaagtatccc
ctggtggagagcacagagtcccagatcctggtgggcatagtgcgaagggcccagctggtg
caggccctgaaggctgagcctccttcctgggctcctggacaccagcagtgtctccaggac
atcttggctgcaggctgccccacagaaccagtgaccctgaagctgtccccagagacttcc
ctgcatgaggcacacaacctctttgagctgttgaaccttcattccctctttgtgacgtcg
cggggcagagctgtgggctgcgtgtcctgggtggagatgaagaaagcaatttccaacctg
acaaatccgccagccccaaagtga

DBGET integrated database retrieval system