KEGG   Homo sapiens (human): 119180Help
Entry
119180            CDS       T01001                                 

Gene name
LYZL2
Definition
lysozyme-like 2 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     119180 (LYZL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p11.23
AA seq 194 aa AA seqDB search
MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCE
GRDLSDWKKDCEVS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgctcccctgagctgcctgtcaccgactaagtggagcagtgtttcttccgca
gactcaactgagaagtcagcctctgcggcaggcaccaggaatctgccttttcagttctgt
ctccggcaggctttgaggatgaaggctgcgggcattctgaccctcattggctgcctggtc
acaggcgccgagtccaaaatctacactcgttgcaaactggcaaaaatattctcgagggct
ggcctggacaattactggggcttcagccttggaaactggatctgcatggcgtattatgag
agcggctacaacaccacagcccagacggtcctggatgacggcagcatcgactacggcatc
ttccagatcaacagcttcgcgtggtgcagacgcggaaagctgaaggagaacaaccactgc
cacgtcgcctgctcagccttggtcactgatgacctcacagatgcgattatctgtgccaag
aaaattgttaaagagacacaaggaatgaactattggcaaggctggaagaaacactgtgag
gggagagacctgtccgactggaaaaaagactgtgaggtttcctaa

DBGET integrated database retrieval system