KEGG   Homo sapiens (human): 1192Help
Entry
1192              CDS       T01001                                 

Gene name
CLIC1, G6, NCC27
Definition
(RefSeq) chloride intracellular channel 1
  KO
K05021  
chloride intracellular channel protein 1
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1192 (CLIC1)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride intracellular channel
   1192 (CLIC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 241 aa AA seqDB search
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
GGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKN
SNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNL
LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaacaaccgcaggtcgaattgttcgtgaaggctggcagtgatggggccaag
attgggaactgcccattctcccagagactgttcatggtactgtggctcaagggagtcacc
ttcaatgttaccaccgttgacaccaaaaggcggaccgagacagtgcagaagctgtgccca
ggggggcagctcccattcctgctgtatggcactgaagtgcacacagacaccaacaagatt
gaggaatttctggaggcagtgctgtgccctcccaggtaccccaagctggcagctctgaac
cctgagtccaacacagctgggctggacatatttgccaaattttctgcctacatcaagaat
tcaaacccagcactcaatgacaatctggagaagggactcctgaaagccctgaaggtttta
gacaattacttaacatcccccctcccagaagaagtggatgaaaccagtgctgaagatgaa
ggtgtctctcagaggaagtttttggatggcaacgagctcaccctggctgactgcaacctg
ttgccaaagttacacatagtacaggtggtgtgtaagaagtaccggggattcaccatcccc
gaggccttccggggagtgcatcggtacttgagcaatgcctacgcccgggaagaattcgct
tccacctgtccagatgatgaggagatcgagctcgcctatgagcaagtggcaaaggccctc
aaataa

DBGET integrated database retrieval system