KEGG   Homo sapiens (human): 119391Help
Entry
119391            CDS       T01001                                 

Gene name
GSTO2, GSTO_2-2, bA127L20.1
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    119391 (GSTO2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    119391 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    119391 (GSTO2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    119391 (GSTO2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    119391 (GSTO2)
  Drug resistance
   01524 Platinum drug resistance
    119391 (GSTO2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     119391 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9H4Y5(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q25.1
AA seq 243 aa AA seqDB search
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgcccctattctcacaggacccgcctc
gtcctcaaggccaaagacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgt
caactgatctatgaatctgttattgcttgtgagtacctggatgatgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actaatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

DBGET integrated database retrieval system