KEGG   Homo sapiens (human): 119391Help
Entry
119391            CDS       T01001                                 

Gene name
GSTO2, GSTO_2-2, bA127L20.1
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    119391 (GSTO2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    119391 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    119391 (GSTO2)
   00983 Drug metabolism - other enzymes
    119391 (GSTO2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    119391 (GSTO2)
   05204 Chemical carcinogenesis
    119391 (GSTO2)
   05225 Hepatocellular carcinoma
    119391 (GSTO2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    119391 (GSTO2)
  Drug resistance
   01524 Platinum drug resistance
    119391 (GSTO2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     119391 (GSTO2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   119391 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 119391
NCBI-ProteinID: NP_899062
OMIM: 612314
HGNC: 23064
Ensembl: ENSG00000065621
Vega: OTTHUMG00000019006
Pharos: Q9H4Y5(Tbio)
UniProt: Q9H4Y5
Structure
PDB: 

Jmol
Position
10q25.1
AA seq 243 aa AA seqDB search
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgcccctattctcacaggacccgcctc
gtcctcaaggccaaagacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgt
caactgatctatgaatctgttattgcttgtgagtacctggatgatgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actaatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

DBGET integrated database retrieval system