KEGG   Homo sapiens (human): 1195Help
Entry
1195              CDS       T01001                                 

Gene name
CLK1, CLK, CLK/STY, STY
Definition
(RefSeq) CDC like kinase 1
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Pathway
Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    1195 (CLK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     1195 (CLK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   1195 (CLK1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    1195 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33
AA seq 484 aa AA seqDB search
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcaaagagaacttactgtcctgattgggatgacaaggattgggattatgga
aaatggaggagcagcagcagtcataaaagaaggaagagatcacatagcagtgcccaggag
aacaagcgctgcaaatacaatcactctaaaatgtgtgatagccattatttggaaagcagg
tctataaatgagaaagattatcatagtcgacgctacattgatgagtacagaaatgactac
actcaaggatgtgaacctggacatcgccaaagagaccatgaaagccggtatcagaaccat
agtagcaagtcttctggtagaagtggaagaagtagttataaaagcaaacacaggattcac
cacagtacttcacatcgtcgttcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggtgaaggagcttttggaaaagttgtggagtgcatcgat
cataaagcgggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatactgt
gaagctgctcgctcagaaatacaagttctggaacatctgaatacaacagaccccaacagt
actttccgctgtgtccagatgttggaatggtttgagcatcatggtcacatttgcattgtt
tttgaactattgggacttagtacttacgacttcattaaagaaaatggttttctaccattt
cgactggatcatatcagaaagatggcatatcagatatgcaagtctgtgaattttttgcac
agtaataagttgactcacacagacttaaagcctgaaaacatcttatttgtgcagtctgac
tacacagaggcgtataatcccaaaataaaacgtgatgaacgcaccttaataaatccagat
attaaagttgtagactttggtagtgcaacatatgatgacgaacatcacagtacattggta
tctacaagacattatagagcacctgaagttattttagccctagggtggtcccaaccatgt
gatgtctggagcataggatgcattcttattgaatactatcttgggtttaccgtatttcca
acacacgatagtaaggagcatttagcaatgatggaaaggattcttggacctctaccaaaa
catatgatacagaaaaccaggaaacgtaaatattttcaccacgatcgattagactgggat
gaacacagttctgccggcagatatgtttcaagacgctgtaaacctctgaaggaatttatg
ctttctcaagatgttgaacatgagcgtctctttgacctcattcagaaaatgttggagtat
gatccagccaaaagaattactctcagagaagccttaaagcatcctttctttgaccttctg
aagaaaagtatatag

DBGET integrated database retrieval system