KEGG   Homo sapiens (human): 1196Help
Entry
1196              CDS       T01001                                 

Gene name
CLK2, hCLK2
Definition
CDC-like kinase 2 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     1196 (CLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   1196 (CLK2)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    1196 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 498 aa AA seqDB search
MPHPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYD
DRSSDRRVYDRRYCGSYRRNDYSRDRGDAYYDTDYRHSYEYQRENSSYRSQRSSRRKHRR
RRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCV
DHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCI
SFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNS
DYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQP
CDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDW
DENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFAR
LRAEPPNKLWDSSRDISR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatcctcgaaggtaccactcctcagagcgaggcagccgggggagttaccgtgaa
cactatcggagccgaaagcataagcgacgaagaagtcgctcctggtcaagtagtagtgac
cggacacgacggcgtcggcgagaggacagctaccatgtccgttctcgaagcagttatgat
gatcgttcgtccgaccggagggtgtatgaccggcgatactgtggcagctacagacgcaac
gattatagccgggatcggggagatgcctactatgacacagactatcggcattcctatgaa
tatcagcgggagaacagcagttaccgcagccagcgcagcagccggaggaagcacagacgg
cggaggaggcgcagccggacatttagccgctcatcttcgcacagcagccggagagccaag
agtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaagag
cgatatgaaatcgttagcaccttaggagaggggaccttcggccgagttgtacaatgtgtt
gaccatcgcaggggtggggctcgagttgccctgaagatcattaagaatgtggagaagtac
aaggaagcagctcgacttgagatcaacgtgctagagaaaatcaatgagaaagaccctgac
aacaagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgtatc
tcctttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctgccc
taccccatccaccaagtgcgccacatggccttccagctgtgccaggctgtcaagttcctc
catgataacaagctgacacatacagacctcaagcctgaaaatattctgtttgtgaattca
gactatgagctcacctacaacctagagaagaagcgagatgagcgcagtgtgaagagcaca
gctgtgcgggtggtagactttggcagtgccacctttgaccatgagcaccatagcaccatt
gtctccactcgccattaccgagcaccagaagtcatccttgagttgggctggtcacagcct
tgtgatgtgtggagtataggctgcatcatctttgaatactatgtgggattcaccctcttc
cagacccatgacaacagagagcatctagccatgatggaaaggatcttgggtcctatccct
tcccggatgatccgaaagacaagaaagcagaaatatttttaccggggtcgcctggattgg
gatgagaacacatcagctgggcgctatgttcgtgagaactgcaaaccgctgcggcggtat
ctgacctcagaggcagaggaacaccaccagctcttcgatctgattgaaagcatgctagag
tatgaaccagctaagcggctgaccttgggtgaagcccttcagcatcctttcttcgcccgc
cttcgggctgagccgcccaacaagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system