KEGG   Homo sapiens (human): 119678Help
Entry
119678            CDS       T01001                                 

Gene name
OR52E2
Definition
(RefSeq) olfactory receptor family 52 subfamily E member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119678 (OR52E2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119678 (OR52E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 119678
NCBI-ProteinID: NP_001005164
HGNC: 14769
Ensembl: ENSG00000176787
Vega: OTTHUMG00000066608
Pharos: Q8NGJ4(Tdark)
UniProt: Q8NGJ4
Position
11p15.4
AA seq 325 aa AA seqDB search
MFLPNDTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYMIALIGNFTILLVIKTDSSLHQP
MFYFLAMLATTDVGLSTATIPKMLGIFWINLRGIIFEACLTQMFFIHNFTLMESAVLVAM
AYDSYVAICNPLQYSAILTNKVVSVIGLGVFVRALIFVIPSILLILRLPFCGNHVIPHTY
CEHMGLAHLSCASIKINIIYGLCAICNLVFDITVIALSYVHILCAVFRLPTHEARLKSLS
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YKCVKKILLQEQGMEKEEYLIHTRF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttccttcccaatgacacccagtttcacccctcctccttcctgttgctggggatccca
ggactagaaacacttcacatctggatcggctttcccttctgtgctgtgtacatgatcgca
ctcatagggaacttcactattctacttgtgatcaagactgacagcagcctacaccagccc
atgttctacttcctggccatgttggccaccactgatgtgggtctctcaacagctaccatc
cctaagatgcttggaatcttctggatcaacctcagagggatcatctttgaagcctgcctc
acccagatgttttttatccacaacttcacacttatggagtcagcagtccttgtggcaatg
gcttatgacagctatgtggccatctgcaatccactccaatatagcgccatcctcaccaac
aaggttgtttctgtgattggtcttggtgtgtttgtgagggctttaattttcgtcattccc
tctatacttcttatattgcggttgcccttctgtgggaatcatgtaattccccacacctac
tgtgagcacatgggtcttgctcatctatcttgtgccagcatcaaaatcaatattatttat
ggtttatgtgccatttgtaatctagtgtttgacatcacagtcattgccctttcttatgtg
catattctttgtgctgttttccgtcttcctactcatgaagcccgactcaagtccctcagc
acatgtggttcacatgtgtgtgtaatccttgccttctatacaccagccctcttttccttt
atgactcatcgctttggccgaaatgtgccccgctatatccatatactcctagccaatctc
tatgttgtggtgccaccaatgctcaatcctgtcatatatggagtcagaaccaagcagatc
tataaatgtgtgaagaaaatattattgcaggaacaaggaatggaaaaggaagagtaccta
atacatacgaggttctga

DBGET integrated database retrieval system