KEGG   Homo sapiens (human): 119678Help
Entry
119678            CDS       T01001                                 

Gene name
OR52E2
Definition
olfactory receptor, family 52, subfamily E, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119678 (OR52E2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119678 (OR52E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 325 aa AA seqDB search
MFLPNDTQFHPSSFLLLGIPGLETLHIWIGFPFCAVYMIALIGNFTILLVIKTDSSLHQP
MFYFLAMLATTDVGLSTATIPKMLGIFWINLRGIIFEACLTQMFFIHNFTLMESAVLVAM
AYDSYVAICNPLQYSAILTNKVVSVIGLGVFVRALIFVIPSILLILRLPFCGNHVIPHTY
CEHMGLAHLSCASIKINIIYGLCAICNLVFDITVIALSYVHILCAVFRLPTHEARLKSLS
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YKCVKKILLQEQGMEKEEYLIHTRF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttccttcccaatgacacccagtttcacccctcctccttcctgttgctggggatccca
ggactagaaacacttcacatctggatcggctttcccttctgtgctgtgtacatgatcgca
ctcatagggaacttcactattctacttgtgatcaagactgacagcagcctacaccagccc
atgttctacttcctggccatgttggccaccactgatgtgggtctctcaacagctaccatc
cctaagatgcttggaatcttctggatcaacctcagagggatcatctttgaagcctgcctc
acccagatgttttttatccacaacttcacacttatggagtcagcagtccttgtggcaatg
gcttatgacagctatgtggccatctgcaatccactccaatatagcgccatcctcaccaac
aaggttgtttctgtgattggtcttggtgtgtttgtgagggctttaattttcgtcattccc
tctatacttcttatattgcggttgcccttctgtgggaatcatgtaattccccacacctac
tgtgagcacatgggtcttgctcatctatcttgtgccagcatcaaaatcaatattatttat
ggtttatgtgccatttgtaatctagtgtttgacatcacagtcattgccctttcttatgtg
catattctttgtgctgttttccgtcttcctactcatgaagcccgactcaagtccctcagc
acatgtggttcacatgtgtgtgtaatccttgccttctatacaccagccctcttttccttt
atgactcatcgctttggccgaaatgtgccccgctatatccatatactcctagccaatctc
tatgttgtggtgccaccaatgctcaatcctgtcatatatggagtcagaaccaagcagatc
tataaatgtgtgaagaaaatattattgcaggaacaaggaatggaaaaggaagagtaccta
atacatacgaggttctga

DBGET integrated database retrieval system