KEGG   Homo sapiens (human): 119682Help
Entry
119682            CDS       T01001                                 

Gene name
OR51L1, OR11-31
Definition
(RefSeq) olfactory receptor family 51 subfamily L member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119682 (OR51L1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119682 (OR51L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 119682
NCBI-ProteinID: NP_001004755
HGNC: 14759
Ensembl: ENSG00000176798
Vega: OTTHUMG00000066605
Pharos: Q8NGJ5(Tdark)
UniProt: Q8NGJ5 A0A126GVJ8
Position
11p15.4
AA seq 315 aa AA seqDB search
MGDWNNSDAVEPIFILRGFPGLEYVHSWLSILFCLAYLVAFMGNVTILSVIWIESSLHQP
MYYFISILAVNDLGMSLSTLPTMLAVLWLDAPEIQASACYAQLFFIHTFTFLESSVLLAM
AFDRFVAICHPLHYPTILTNSVIGKIGLACLLRSLGVVLPTPLLLRHYHYCHGNALSHAF
CLHQDVLRLSCTDARTNSIYGLCVVIATLGVDSIFILLSYVLILNTVLDIASREEQLKAL
NTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPIVHILMADIYLLLPPVLNPIVYSVRTKQ
IRLGILHKFVLRRRF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgggagactggaataacagtgatgctgtggagcccatatttatcctgaggggttttcct
ggactggagtatgttcattcttggctctccatcctcttctgtcttgcatatttggtagca
tttatgggtaatgttaccatcctgtctgtcatttggatagaatcctctctccatcagccc
atgtattactttatttccatcttagcagtgaatgacctggggatgtccctgtctacactt
cccaccatgcttgctgtgttatggttggatgctccagagatccaggcaagtgcttgctat
gctcagctgttcttcatccacacattcacattcctggagtcctcagtgttgctggccatg
gcctttgaccgttttgttgctatctgccatccactgcactaccccaccatcctcaccaac
agtgtaattggcaaaattggtttggcctgtttgctacgaagcttgggagttgtacttccc
acacctttgctactgagacactatcactactgccatggcaatgccctctctcacgccttc
tgtttgcaccaggatgttctaagattatcctgtacagatgccaggaccaacagtatttat
gggctttgtgtagtcattgccacactaggtgtggattcaatcttcatacttctttcttat
gttctgattcttaatactgtgctggatattgcatctcgtgaagagcagctaaaggcactc
aacacatgtgtatcccatatctgtgtggtgcttatcttctttgtgccagttattggggtg
tcaatggtccatcgctttgggaagcatctgtctcccatagtccacatcctcatggcagac
atctaccttcttcttcccccagtccttaaccctattgtctatagtgtcagaacaaagcag
attcgtctaggaattctccacaagtttgtcctaaggaggaggttttaa

DBGET integrated database retrieval system