KEGG   Homo sapiens (human): 119749Help
Entry
119749            CDS       T01001                                 

Gene name
OR4C46
Definition
olfactory receptor, family 4, subfamily C, member 46
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119749 (OR4C46)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119749 (OR4C46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.12
AA seq 309 aa AA seqDB search
MENRNNMTEFVLLGLTENPKMQKIIFVVFFVIYIITVVGYVLIVVTITASPSLGSPMYLS
LAYLSFIDACYSSVNTPNLITHSLYGKKAILFNGCMTQVFGEHFFGGAEGILLTVMAYDH
YVAICKPLHYMTIMNQCVCALLMGVVWMGGFLHATIQILFIFQLPFCGPNVIDHFMCDLN
PLLNLACTDTHMLELFIAANSGFICLLNFALLLVSYVVILCSLRTHSLEARHKALSTCVS
HITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLKNAQMKNAIRKLC
SRKDISGDK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaataggaataacatgacagagtttgttttgctggggcttacagagaatccaaag
atgcagaaaatcatatttgttgtgttttttgtcatctatatcatcactgtggtgggatat
gtgctcattgtggtcaccatcactgccagcccatcactggggtcccccatgtacctttcc
ctggcctatctctcctttattgatgcctgctattcctctgtcaatacccctaacctgatc
acacattcactctatggaaagaaggccatcctattcaatggatgcatgactcaagtcttt
ggagaacatttcttcggaggtgcagagggcatcctacttactgtgatggcctatgaccac
tatgtggccatctgcaagcccttgcactatatgactatcatgaaccagtgtgtgtgtgcc
ctgctaatgggagtggtgtggatgggaggctttcttcatgcaaccatacagatcctcttc
atcttccaattacctttctgtggtcctaatgtcatagatcactttatgtgtgatctgaac
cctttgctcaacctcgcctgcactgacacccatatgctggaactcttcattgctgccaac
agtggattcatctgcttgttaaactttgccctcctgctggtctcctatgtggtcatcttg
tgctccctaaggactcatagcttggaggcaaggcacaaagccctctccacctgtgtctcc
cacatcacggttgtcatcttattctttgtgccctgcatatttgtgtacatgagacctgca
gctactttacctattgataaagcagttgctatattctacactatgataactcctatgtta
aaccccttaatctataccttgaagaatgcccagatgaaaaatgccatcaggaaattgtgt
agtagaaaggacatttcaggtgacaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system