KEGG   Homo sapiens (human): 119749Help
Entry
119749            CDS       T01001                                 

Gene name
OR4C46
Definition
(RefSeq) olfactory receptor family 4 subfamily C member 46
  KO
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119749 (OR4C46)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119749 (OR4C46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.12
AA seq 309 aa AA seqDB search
MENRNNMTEFVLLGLTENPKMQKIIFVVFFVIYIITVVGYVLIVVTITASPSLGSPMYLS
LAYLSFIDACYSSVNTPNLITHSLYGKKAILFNGCMTQVFGEHFFGGAEGILLTVMAYDH
YVAICKPLHYMTIMNQCVCALLMGVVWMGGFLHATIQILFIFQLPFCGPNVIDHFMCDLN
PLLNLACTDTHMLELFIAANSGFICLLNFALLLVSYVVILCSLRTHSLEARHKALSTCVS
HITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLKNAQMKNAIRKLC
SRKDISGDK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaataggaataacatgacagagtttgttttgctggggcttacagagaatccaaag
atgcagaaaatcatatttgttgtgttttttgtcatctatatcatcactgtggtgggatat
gtgctcattgtggtcaccatcactgccagcccatcactggggtcccccatgtacctttcc
ctggcctatctctcctttattgatgcctgctattcctctgtcaatacccctaacctgatc
acacattcactctatggaaagaaggccatcctattcaatggatgcatgactcaagtcttt
ggagaacatttcttcggaggtgcagagggcatcctacttactgtgatggcctatgaccac
tatgtggccatctgcaagcccttgcactatatgactatcatgaaccagtgtgtgtgtgcc
ctgctaatgggagtggtgtggatgggaggctttcttcatgcaaccatacagatcctcttc
atcttccaattacctttctgtggtcctaatgtcatagatcactttatgtgtgatctgaac
cctttgctcaacctcgcctgcactgacacccatatgctggaactcttcattgctgccaac
agtggattcatctgcttgttaaactttgccctcctgctggtctcctatgtggtcatcttg
tgctccctaaggactcatagcttggaggcaaggcacaaagccctctccacctgtgtctcc
cacatcacggttgtcatcttattctttgtgccctgcatatttgtgtacatgagacctgca
gctactttacctattgataaagcagttgctatattctacactatgataactcctatgtta
aaccccttaatctataccttgaagaatgcccagatgaaaaatgccatcaggaaattgtgt
agtagaaaggacatttcaggtgacaaataa

DBGET integrated database retrieval system