KEGG   Homo sapiens (human): 119764Help
Entry
119764            CDS       T01001                                 

Gene name
OR4X2, OR11-105
Definition
(RefSeq) olfactory receptor family 4 subfamily X member 2 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    119764 (OR4X2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    119764 (OR4X2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 119764
NCBI-ProteinID: NP_001004727
HGNC: 15184
Ensembl: ENSG00000172208
Vega: OTTHUMG00000165302
Pharos: Q8NGF9(Tdark)
UniProt: Q8NGF9 A0A126GVL5
Position
11p11.2
AA seq 303 aa AA seqDB search
MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSF
MEICYSSATAPKLISDLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICK
PLSYTTIMNWQVCTVLVGIAWVGGFMHSFAQILLIFHLLFCGPNVINHYFCDLVPLLKLA
CSDTFLIGLLIVANGGTLSVISFGVLLASYMVILLHLRTWSSEGWCKALSTCGSHFAVVI
LFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYSLRNAEMRKAMKRLWIRTLRL
NEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcatttttctggtactttctcccaaccaggaggtgcagagggtttgcttt
gtgatatttctgttcttgtacacagcaattgtgctggggaatttcctcattgtgctcact
gtcatgaccagcagaagccttggttcccccatgtacttcttcctcagctacctctccttc
atggagatctgctactcctccgctacagcccccaaactcatctcagatctgctggctgaa
aggaaagtcatatcttggtggggctgcatggcacagcttttcttcttgcacttctttggt
ggcactgagattttcctgctcactgtgatggcctatgaccactatgtggccatctgcaag
cccctcagctacaccaccatcatgaactggcaggtgtgtactgtccttgtaggaatagca
tgggtgggaggcttcatgcattcctttgcacaaatccttctcatcttccacctgctcttc
tgtggccccaatgtgatcaatcactatttctgtgacctagttccccttctcaaacttgcc
tgctctgacaccttcctcattggtctgctgattgttgccaatggaggcaccctgtctgtg
atcagttttggggtcctcttagcatcctatatggtcatcttgctccatctgagaacctgg
agctctgaagggtggtgcaaagccctctccacctgtgggtcccatttcgctgtggttatc
ttgttctttgggccctgcgtcttcaactctctgaggccttctaccactctgcccatagac
aagatggtggctgtgttctacacagtgataaccgcgatcctgaaccctgtcatctactct
ctgagaaatgctgaaatgaggaaggccatgaagaggctgtggattaggacattgagacta
aatgagaaatag

DBGET integrated database retrieval system