KEGG   Homo sapiens (human): 12Help
Entry
12                CDS       T01001                                 

Gene name
SERPINA3, AACT, ACT, GIG24, GIG25
Definition
(RefSeq) serpin family A member 3
  KO
K04525  serpin peptidase inhibitor, clade A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin KicB
Motif
Other DBs
NCBI-GeneID: 12
NCBI-ProteinID: NP_001076
OMIM: 107280
HGNC: 16
Ensembl: ENSG00000196136
Vega: OTTHUMG00000029851
Pharos: P01011(Tbio)
UniProt: P01011 A0A024R6P0
Structure
PDB: 

Jmol
Position
14q32.13
AA seq 423 aa AA seqDB search
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSL
YKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQ
HLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVM
VPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWR
DSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
KQA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggagagaatgttacctctcctggctctggggctcttggcggctgggttctgccctgct
gtcctctgccaccctaacagcccacttgacgaggagaatctgacccaggagaaccaagac
cgagggacacacgtggacctcggattagcctccgccaacgtggacttcgctttcagcctg
tacaagcagttagtcctgaaggcccctgataagaatgtcatcttctccccactgagcatc
tccaccgccttggccttcctgtctctgggggcccataataccaccctgacagagattctc
aaaggcctcaagttcaacctcacggagacttctgaggcagaaattcaccagagcttccag
cacctcctgcgcaccctcaatcagtccagcgatgagctgcagctgagtatgggaaatgcc
atgtttgtcaaagagcaactcagtctgctggacaggttcacggaggatgccaagaggctg
tatggctccgaggcctttgccactgactttcaggactcagctgcagctaagaagctcatc
aacgactacgtgaagaatggaactagggggaaaatcacagatctgatcaaggaccttgac
tcgcagacaatgatggtcctggtgaattacatcttctttaaagccaaatgggagatgccc
tttgacccccaagatactcatcagtcaaggttctacttgagcaagaaaaagtgggtaatg
gtgcccatgatgagtttgcatcacctgactataccttacttccgggacgaggagctgtcc
tgcaccgtggtggagctgaagtacacaggcaatgccagcgcactcttcatcctccctgat
caagacaagatggaggaagtggaagccatgctgctcccagagaccctgaagcggtggaga
gactctctggagttcagagagataggtgagctctacctgccaaagttttccatctcgagg
gactataacctgaacgacatacttctccagctgggcattgaggaagccttcaccagcaag
gctgacctgtcagggatcacaggggccaggaacctagcagtctcccaggtggtccataag
gctgtgcttgatgtatttgaggagggcacagaagcatctgctgccacagcagtcaaaatc
accctcctttctgcattagtggagacaaggaccattgtgcgtttcaacaggcccttcctg
atgatcattgtccctacagacacccagaacatcttcttcatgagcaaagtcaccaatccc
aagcaagcctag

DBGET integrated database retrieval system