KEGG   Homo sapiens (human): 120065Help
Entry
120065            CDS       T01001                                 

Gene name
OR5P2, JCG3, JCG4
Definition
olfactory receptor, family 5, subfamily P, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 322 aa AA seqDB search
MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLS
HLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFV
AICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPL
LELSCSDISVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSH
LTVVTLFYGTITFIYVMPNFSYSTDQNKVVSVLYTVVIPMLNPLIYSLRNKEIKGALKRE
LVRKILSHDACYFSRTSNNDIT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaattccctgaaggacgggaatcacaccgctctgacggggttcatcctattgggctta
acagatgatccaatccttcgagtcatcctcttcatgatcatcctatctggtaatctcagc
ataattattcttatcagaatttcttctcagctccatcatcctatgtatttctttctgagc
cacttggcttttgctgacatggcctattcatcttctgtcacacccaacatgcttgtaaac
ttcctggtggagagaaatacagtctcctaccttggatgtgccatccagcttggttcagcg
gctttctttgcaacagtcgaatgcgtccttctggctgccatggcctatgaccgctttgtg
gcaatttgcagtccactgctttattcaaccaaaatgtccacacaagtcagtgtccagcta
ctcttagtagtttacatagctggttttctcattgctgtctcctatactacttccttctat
tttttactcttctgtggaccaaatcaagtcaatcattttttctgtgatttcgctccctta
cttgaactctcctgttctgatatcagtgtctccacagttgttctctcattttcttctgga
tccatcattgtggtcactgtgtgtgtcatagccgtctgctacatctatatcctcatcacc
atcctgaagatgcgctccactgaggggcaccacaaggccttctccacctgcacttcccac
ctcactgtggttaccctgttctatgggaccattaccttcatttatgtgatgcccaatttt
agctactcaactgaccagaacaaggtggtgtctgtgttgtacacagtggtgattcccatg
ttgaaccccctgatctacagcctcaggaacaaggagattaagggggctctgaagagagag
cttgttagaaaaatactttctcatgatgcttgttattttagtagaacttcaaataatgat
attacatag

DBGET integrated database retrieval system