KEGG   Homo sapiens (human): 1207Help
Entry
1207              CDS       T01001                                 

Gene name
CLNS1A, CLCI, CLNS1B, ICln
Definition
chloride channel, nucleotide-sensitive, 1A
Orthology
K05019  
chloride channel, nucleotide-sensitive, 1A
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.5-q14
AA seq 237 aa AA seqDB search
MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPT
ISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKS
ALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAE
GQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcctcaaaagtttcccgccgcctgggccagcggaggggctcctgcggcagcag
ccagacactgaggctgtgctgaacgggaagggcctcggcactggtaccctttacatcgct
gagagccgcctgtcttggttagatggctctggattaggattctcactggaataccccacc
attagtttacatgcattatccagggaccgaagtgactgtctaggagagcatttgtatgtt
atggtgaatgccaaatttgaagaagaatcaaaagaacctgttgctgatgaagaagaggaa
gacagtgatgatgatgttgaacctattactgaatttagatttgtgcctagtgataaatca
gcgttggaggcaatgttcactgcaatgtgcgaatgccaggccttgcatccagatcctgag
gatgaggattcagatgactacgatggagaagaatatgatgtggaagcacatgaacaagga
cagggggacatccctacattttacacctatgaagaaggattatcccatctaacagcagaa
ggccaagccacactggagagattagaaggaatgctttctcagtctgtgagcagccagtat
aatatggctggggtcaggacagaagattcaataagagattatgaagatgggatggaggtg
gataccacaccaacagttgctggacagtttgaggatgcagatgttgatcactga

DBGET integrated database retrieval system