KEGG   Homo sapiens (human): 1207Help
Entry
1207              CDS       T01001                                 

Gene name
CLNS1A, CLCI, CLNS1B, ICln
Definition
chloride channel, nucleotide-sensitive, 1A
Orthology
K05019  
chloride channel, nucleotide-sensitive, 1A
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1207 (CLNS1A)
Ion channels [BR:hsa04040]
 Chloride channels
  Nucleotide sensitive chloride channel
   1207 (CLNS1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.5-q14
AA seq 237 aa AA seqDB search
MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPT
ISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKS
ALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAE
GQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcctcaaaagtttcccgccgcctgggccagcggaggggctcctgcggcagcag
ccagacactgaggctgtgctgaacgggaagggcctcggcactggtaccctttacatcgct
gagagccgcctgtcttggttagatggctctggattaggattctcactggaataccccacc
attagtttacatgcattatccagggaccgaagtgactgtctaggagagcatttgtatgtt
atggtgaatgccaaatttgaagaagaatcaaaagaacctgttgctgatgaagaagaggaa
gacagtgatgatgatgttgaacctattactgaatttagatttgtgcctagtgataaatca
gcgttggaggcaatgttcactgcaatgtgcgaatgccaggccttgcatccagatcctgag
gatgaggattcagatgactacgatggagaagaatatgatgtggaagcacatgaacaagga
cagggggacatccctacattttacacctatgaagaaggattatcccatctaacagcagaa
ggccaagccacactggagagattagaaggaatgctttctcagtctgtgagcagccagtat
aatatggctggggtcaggacagaagattcaataagagattatgaagatgggatggaggtg
gataccacaccaacagttgctggacagtttgaggatgcagatgttgatcactga

DBGET integrated database retrieval system