KEGG   Homo sapiens (human): 120775Help
Entry
120775            CDS       T01001                                 

Gene name
OR2D3, OR11-89
Definition
(RefSeq) olfactory receptor family 2 subfamily D member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    120775 (OR2D3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    120775 (OR2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 120775
NCBI-ProteinID: NP_001004684
HGNC: 15146
Ensembl: ENSG00000178358
Vega: OTTHUMG00000165742
Pharos: Q8NGH3(Tdark)
UniProt: Q8NGH3
Position
11p15.4
AA seq 330 aa AA seqDB search
MCSFFLCQTGKQAKISMGEENQTFVSKFIFLGLSQDLQTQILLFILFLIIYLLTVLGNQL
IIILIFLDSRLHTPMYFFLRNLSFADLCFSTSIVPQVLVHFLVKRKTISFYGCMTQIIVF
LLVGCTECALLAVMSYDRYVAVCKPLYYSTIMTQRVCLWLSFRSWASGALVSLVDTSFTF
HLPYWGQNIINHYFCEPPALLKLASIDTYSTEMAIFSMGVVILLAPVSLILGSYWNIIST
VIQMQSGEGRLKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKELDKMISVFYTAVTPM
LNPIIYSLRNKDVKGALRKLVGRKCFSHRQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcttttttcttgtgccaaacaggtaaacaggcaaaaatatcaatgggagaagaa
aaccaaacctttgtgtccaagtttatcttcctgggtctttcacaggacttgcagacccag
atcctgctatttatccttttcctcatcatttatctgctgaccgtgcttggaaaccagctc
atcatcattctcatcttcctggattctcgccttcacactcccatgtatttttttcttaga
aatctctcctttgcagatctctgtttctctactagcattgtccctcaagtgttggttcac
ttcttggtaaagaggaaaaccatttctttttatgggtgtatgacacagataattgtcttt
cttctggttgggtgtacagagtgtgcgctgctggcagtgatgtcctatgaccggtatgtg
gctgtctgcaagcccctgtactactctaccatcatgacacaacgggtgtgtctctggctg
tccttcaggtcctgggccagtggggcactagtgtctttagtagataccagctttactttc
catcttccctactggggacagaatataatcaatcactacttttgtgaacctcctgccctc
ctgaagctggcttccatagacacttacagcacagaaatggccatcttttcaatgggcgtg
gtaatcctcctggcccctgtctccctgattcttggttcttattggaatattatctccact
gttatccagatgcagtctggggaagggagactcaaggctttttccacctgtggctcccat
cttattgttgttgtcctcttctatgggtcaggaatattcacctacatgcgaccaaactcc
aagactacaaaagaactggataaaatgatatctgtgttctatacagcggtgactccaatg
ttgaaccccataatttatagcttgaggaacaaagatgtcaaaggggctctcaggaaacta
gttgggagaaagtgcttctctcataggcagtga

DBGET integrated database retrieval system