KEGG   Homo sapiens (human): 120776Help
Entry
120776            CDS       T01001                                 

Gene name
OR2D2, OR11-610, OR2D1, hg27
Definition
(RefSeq) olfactory receptor family 2 subfamily D member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    120776 (OR2D2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    120776 (OR2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 120776
NCBI-ProteinID: NP_003691
OMIM: 608494
HGNC: 8244
Ensembl: ENSG00000166368
Vega: OTTHUMG00000165741
Pharos: Q9H210(Tdark)
UniProt: Q9H210 A0A126GVN9
Position
11p15.4
AA seq 308 aa AA seqDB search
MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY
FFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSY
DRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCE
APALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFST
CGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPMLNPLIYSLRNKDVKAALR
KVATRNFP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagacagataaatcagacacaagtgacagaattcctccttctgggactctctgatggg
ccacacaccgagcagctgctatttatcgtattattgggtgtctacctggtcactgtgctt
ggaaatctgcttctaatctcccttgttcatgttgactcccaacttcacacacccatgtat
ttttttctctgcaacttgtctctggctgacctctgtttctctaccaacatagttcctcag
gcactagtccacctgctttccagaaagaaggtcattgcattcacactttgcgcagctcga
cttctctttttcctcatttttgggtgtacccagtgcgcccttcttgcagtgatgtcctat
gatcgctatgttgcaatctgcaatcctctgcgttaccctaacatcatgacctggaaagtg
tgtgtccagctggcaacaggatcatggaccagtggcattctggtgtctgtggtagacacc
accttcatactgaggctaccctaccgaggcagtaacagcattgctcatttcttttgtgag
gcccctgcactattgatcttagcatccacagacacccatgcatcagagatggccattttt
cttatgggggttgtgattctcctcatacctgtttttctgattctggtatcctatggccgt
atcatagtaactgtggtcaagatgaagtcaactgtggggagtctcaaggcattttctacc
tgtggctcccacctcatggtggtcatacttttttatggatcagcaattatcacttacatg
acacccaagtcttccaaacagcaggaaaaatcggtgtctgttttctatgcaatagtgact
cccatgcttaatcccctcatctatagcctgagaaacaaggatgtgaaggcagctctgagg
aaagtagccacaaggaatttcccatga

DBGET integrated database retrieval system