KEGG   Homo sapiens (human): 120793Help
Entry
120793            CDS       T01001                                 

Gene name
OR56A4, OR11-49
Definition
olfactory receptor, family 56, subfamily A, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    120793 (OR56A4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    120793 (OR56A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 365 aa AA seqDB search
MMTVILKTLLGQIQGLSGNPHSTTSRMYFLCFCTSLLRFKVHWVSRLIRKLYMASPSNDS
TAPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHQPLYYLLSL
LSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQMFIMNSFLTMESCTFMVMAYDRYVA
ICHPLRYPSIITDQFVARAVVFVIARNAFVSLPVPMLSARLRYCAGNIIKNCICSNLSVS
KLSCDDITFNQLYQFVAGWTLLGSDLILIVISYSFILKVVLRIKAEGAVAKALSTCGSHF
ILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTKEIKQGIQN
LLKRL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtgattttaaaaactttattgggacagatacagggcctcagtggaaaccca
cactctactacgtctagaatgtactttttatgtttctgtacttctctactacgttttaag
gtacactgggtctccagattgatcaggaaactttacatggcatctcccagcaatgactcc
actgccccagtctctgaattcctcctcatctgcttccccaacttccagagctggcagcac
tggttgtctctgcccctcagccttctcttcctcctggccatgggagctaacaccaccctc
ctgatcaccatccagctggaggcctctctgcaccagcccctgtactacctgctcagcctc
ctctccctgctggacatcgtgctctgcctcaccgtcatccccaaggtcctggccatcttc
tggtttgacctcaggtcgatcagcttcccagcctgcttcctccagatgttcatcatgaac
agttttttgaccatggagtcctgcacgttcatggtcatggcctatgaccgttatgtggcc
atctgccatccattgagatacccgtctatcatcactgaccagtttgtggctagggccgtg
gtctttgttatagcccggaatgcctttgtttctcttcctgttcccatgctttctgccagg
ctcagatactgtgcaggaaacataatcaagaactgcatctgcagtaacctgtctgtgtcc
aaactctcttgtgatgacatcactttcaatcagctctaccagtttgtggcaggctggact
ctgttgggctctgatcttatccttattgttatctcctattcttttatattgaaagttgtg
cttaggatcaaggccgagggtgctgtggccaaggccttgagcacgtgtggttcccacttc
atcctcatcctcttcttcagcacagtcctgctggttctggtcatcactaacctggccagg
aagagaattcctccagatgtccccatcctgctcaacatcctgcaccacctcattccccca
gctctgaaccccattgtttatggtgtgagaaccaaggagatcaagcagggaatccaaaac
ctgctgaagaggttgtaa

DBGET integrated database retrieval system