KEGG   Homo sapiens (human): 1208Help
Entry
1208              CDS       T01001                                 

Gene name
CLPS
Definition
colipase, pancreatic
Orthology
K14460  
colipase
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Class
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.31
AA seq 98 aa AA seqDB search
MILLPQPPKKLGLQENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGI
YYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgattctcctgcctcagcctcccaagaagctgggattacaggagaacggtgagctctgc
atgaatagtgcccagtgtaagagcaattgctgccagcattcaagtgcgctgggcctggcc
cgctgcacatccatggccagcgagaacagcgagtgctctgtcaagacgctctatgggatt
tactacaagtgtccctgtgagcgtggcctgacctgtgagggagacaagaccatcgtgggc
tccatcaccaacaccaactttggcatctgccatgacgctggacgctccaagcagtga

DBGET integrated database retrieval system