KEGG   Homo sapiens (human): 1208Help
Entry
1208              CDS       T01001                                 

Gene name
CLPS
Definition
colipase, pancreatic
Orthology
K14460  
colipase
Organism
hsa  Homo sapiens (human)
Pathway
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    1208 (CLPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.31
AA seq 98 aa AA seqDB search
MILLPQPPKKLGLQENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGI
YYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgattctcctgcctcagcctcccaagaagctgggattacaggagaacggtgagctctgc
atgaatagtgcccagtgtaagagcaattgctgccagcattcaagtgcgctgggcctggcc
cgctgcacatccatggccagcgagaacagcgagtgctctgtcaagacgctctatgggatt
tactacaagtgtccctgtgagcgtggcctgacctgtgagggagacaagaccatcgtgggc
tccatcaccaacaccaactttggcatctgccatgacgctggacgctccaagcagtga

DBGET integrated database retrieval system