KEGG   Homo sapiens (human): 1211Help
Entry
1211              CDS       T01001                                 

Gene name
CLTA, LCA
Definition
clathrin, light chain A
Orthology
K04644  
clathrin light chain A
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1211 (CLTA)
   04142 Lysosome
    1211 (CLTA)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1211 (CLTA)
  Nervous system
   04721 Synaptic vesicle cycle
    1211 (CLTA)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1211 (CLTA)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1211 (CLTA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   1211 (CLTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 236 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
AAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctggatccgttcggcgcccctgccggcgcccctggcggtcccgcgctgggg
aacggagtggccggcgccggcgaagaagacccggctgcggccttcttggcgcagcaagag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggcgccccc
gggccccagccgcacggcgagccgccggggggtccggatgctgttgatggagtaatgaat
ggtgaatactaccaggaaagtaatggtccaacagacagttatgcagctatttcacaagtg
gatcgattgcagtcagagcctgaaagtatccgtaaatggagagaagaacaaatggaacgc
ttggaagcccttgatgccaattctcggaagcaagaagcagagtggaaagaaaaggcaata
aaggagctagaagaatggtatgcaagacaggacgagcagctacagaaaacaaaagcaaac
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtg
gcagcagaagaagcctttgtaaatgacattgacgagtcgtccccaggcactgagtgggaa
cgggtggcccggctgtgtgactttaaccccaagtctagcaagcaggccaaagatgtctcc
cgcatgcgctcagtcctcatctccctcaagcaggccccgctggtgcactga

DBGET integrated database retrieval system