KEGG   Homo sapiens (human): 1211Help
Entry
1211              CDS       T01001                                 

Gene name
CLTA, LCA
Definition
clathrin, light chain A
Orthology
K04644  
clathrin light chain A
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 236 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
AAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctggatccgttcggcgcccctgccggcgcccctggcggtcccgcgctgggg
aacggagtggccggcgccggcgaagaagacccggctgcggccttcttggcgcagcaagag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggcgccccc
gggccccagccgcacggcgagccgccggggggtccggatgctgttgatggagtaatgaat
ggtgaatactaccaggaaagtaatggtccaacagacagttatgcagctatttcacaagtg
gatcgattgcagtcagagcctgaaagtatccgtaaatggagagaagaacaaatggaacgc
ttggaagcccttgatgccaattctcggaagcaagaagcagagtggaaagaaaaggcaata
aaggagctagaagaatggtatgcaagacaggacgagcagctacagaaaacaaaagcaaac
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtg
gcagcagaagaagcctttgtaaatgacattgacgagtcgtccccaggcactgagtgggaa
cgggtggcccggctgtgtgactttaaccccaagtctagcaagcaggccaaagatgtctcc
cgcatgcgctcagtcctcatctccctcaagcaggccccgctggtgcactga

DBGET integrated database retrieval system