KEGG   Homo sapiens (human): 121129Help
Entry
121129            CDS       T01001                                 

Gene name
OR2AP1, OR2AP1P
Definition
(RefSeq) olfactory receptor family 2 subfamily AP member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    121129 (OR2AP1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    121129 (OR2AP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 CitMHS
Motif
Other DBs
NCBI-GeneID: 121129
NCBI-ProteinID: NP_001245214
HGNC: 15335
Ensembl: ENSG00000179615
Vega: OTTHUMG00000169960
Pharos: Q8NGE2(Tdark)
UniProt: Q8NGE2 A0A126GVS5
Position
12q13.2
AA seq 309 aa AA seqDB search
MKNKTVLTEFILLGLTDVPELQVAVFTFLFLAYLLSILGNLTILILTLLDSHLQTPMYFF
LRNFSFLEISFTNIFIPRVLISITTGNKSISFAGCFTQYFFAMFLGATEFYLLAAMSYDR
YVAICKPLHYTTIMSSRICIQLIFCSWLGGLMAIIPTITLMSQQDFCASNRLNHYFCDYE
PLLELSCSDTSLIEKVVFLVASVTLVVTLVLVILSYAFIIKTILKLPSAQQRTKAFSTCS
SHMIVISLSYGSCMFMYINPSAKEGDTFNKGVALLITSVAPLLNPFIYTLRNQQVKQPFK
DMVKKLLNL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaaccgtgttaactgagtttatccttctgggtctaacagatgtccctgaa
ctccaggtggcagttttcacctttcttttccttgcgtatttactcagcatccttggaaat
ctgactatcctcatcctcaccttgctggactcccaccttcagactcccatgtatttcttt
ctccggaacttctccttcttggaaatttccttcacaaacatcttcattccaagggtcctg
attagcatcacaacagggaacaagagtatcagctttgctggctgcttcactcagtatttc
tttgccatgttccttggggctacagagttttaccttctggctgccatgtcctatgaccgc
tatgtggccatctgcaaacctctgcattacaccaccatcatgagcagcagaatctgcatc
cagctgattttctgctcttggctgggtgggctaatggctattataccaacaatcaccctg
atgagtcagcaggacttttgtgcatccaacagactgaatcattacttctgtgactatgag
cctcttctggaactctcatgttcagacacaagcctcatagagaaggttgtctttcttgtg
gcatctgtgaccctggtggtcactctggtgctagtgattctctcctatgcattcattatc
aagactattctgaagctcccctctgcccaacaaaggacaaaagccttttccacatgttct
tcccacatgattgtcatctccctctcttacggaagctgcatgtttatgtacattaatccc
tctgcaaaagaaggggatacattcaacaagggagtagctctactcattacttcagttgct
cctttgttgaacccctttatttacaccctaaggaaccaacaggtaaaacaacccttcaag
gatatggtcaaaaagcttctgaatctttaa

DBGET integrated database retrieval system