KEGG   Homo sapiens (human): 121275Help
Entry
121275            CDS       T01001                                 

Gene name
OR10AD1, OR10AD1P, OR12-1
Definition
olfactory receptor, family 10, subfamily AD, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    121275 (OR10AD1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    121275 (OR10AD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.11
AA seq 317 aa AA seqDB search
MLRNGSIVTEFILVGFQQSSTSTRALLFALFLALYSLTMAMNGLIIFITSWTDPKLNSPM
YFFLGHLSLLDVCFITTTIPQMLIHLVVRDHIVSFVCCMTQMYFVFCVGVAECILLAFMA
YDRYVAICYPLNYVPIISQKVCVRLVGTAWFFGLINGIFLEYISFREPFRRDNHIESFFC
EAPIVIGLSCGDPQFSLWAIFADAIVVILSPMVLTVTSYVHILATILSKASSSGRGKTFS
TCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFSLLYTIITPMCNPIIYSFRNKEIKE
AMVRALGRTRLAQPQSV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggaatggcagcatagtgacggaatttatcctcgtgggctttcagcagagctcc
acttccacacgagcattgctctttgccctcttcttggccctctacagcctcaccatggcc
atgaatggcctcatcatctttatcacctcctggacagaccccaagctcaacagccccatg
tacttcttcctcggccatctgtctctcctggatgtctgcttcatcaccactaccatccca
cagatgttgatccacctcgtggtcagggaccacattgtctcctttgtatgttgcatgacc
cagatgtactttgtcttctgtgttggtgtggccgagtgcatcctcttggctttcatggcc
tatgaccgttatgttgctatctgctacccacttaactatgtcccgatcataagccagaag
gtctgtgtcaggcttgtgggaactgcctggttctttgggctgatcaatggcatctttctc
gagtatatttcattccgagagcccttccgcagagacaaccacatagaaagcttcttctgt
gaggcccccatagtgattggcctctcttgtggggaccctcagtttagtctgtgggcaatc
tttgccgatgccatcgtggtaattctcagccccatggtgctcactgtcacttcctatgtg
cacatcctggccaccatcctcagcaaagcctcctcctcaggtcgggggaagactttctct
acttgtgcctctcacctgactgtggtcatctttctctacacttcagctatgttctcttac
atgaacccccacagcacacatgggcctgacaaagacaaacctttctccctcctgtacacc
atcattacccccatgtgcaaccccatcatttatagtttccgcaacaaggaaattaaggag
gccatggtgagggcacttggaagaaccaggctggcccagccacagtctgtctag

DBGET integrated database retrieval system