KEGG   Homo sapiens (human): 121364Help
Entry
121364            CDS       T01001                                 

Gene name
OR10A7, OR12-6
Definition
(RefSeq) olfactory receptor family 10 subfamily A member 7
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    121364 (OR10A7)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    121364 (OR10A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 121364
NCBI-ProteinID: NP_001005280
HGNC: 15329
Ensembl: ENSG00000179919
Vega: OTTHUMG00000169860
Pharos: Q8NGE5(Tdark)
UniProt: Q8NGE5 A0A126GVR3
Position
12q13.2
AA seq 316 aa AA seqDB search
MICENHTRVTEFILLGFTNNPEMQVSLFIFFLAIYTVTLLGNFLIVTVTSVDLALQTPMY
FFLQNLSLLEVCFTLVMVPKMLVDLVSPRKIISFVGCGTQMYFFFFFGSSECFLLSMMAY
DRFVAICNPLHYSVIMNRSLCLWMAIGSWMSGVPVSMLQTAWMMALPFCGPNAVDHFFCD
GPPVLKLVTVDTTMYEMQALASTLLFIMFPFCLILVSYTRIIITILRMSSATGRQKAFST
CSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTVITPMLNPIIYGLRNNEVKGA
VKRTITQKVLQKLDVF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtgaaaatcacaccagagtcactgaatttattcttcttggttttacaaacaac
cccgagatgcaagtttccctctttatttttttcctggccatttatacagtcactttgttg
ggcaactttcttattgtcacagttaccagtgtggatctcgcacttcaaacacccatgtac
ttctttcttcaaaatctgtcacttcttgaagtatgtttcaccttggttatggtgccaaaa
atgcttgtagatctagtgtccccaaggaaaattatctcttttgtgggctgtggtacccag
atgtacttcttcttcttctttggcagttctgaatgtttccttctctccatgatggcttat
gatcgctttgtggccatctgtaaccctctccattattcagtcataatgaacaggtcccta
tgcttgtggatggccataggctcttggatgtccggtgttcctgtgtctatgctacagaca
gcttggatgatggcccttcctttctgtggaccaaatgccgtggaccactttttctgtgat
ggtcccccagtgttaaaactagtcacagtggatacaaccatgtatgaaatgcaagcactt
gcctccacactcctgtttatcatgtttcccttttgtctcattttggtttcctacacccgc
attatcataacaattctgaggatgtcctctgccactggccgccagaaggcattttctact
tgttcctcacacctcattgtggtgtccctcttctacggaacagccagtctgacctacctg
cggcccaaatcaaaccagtcccctgagagcaagaagctagtgtcattgtcctacactgtc
atcacacctatgctaaaccccatcatctacggcctgaggaacaatgaagtgaaaggggct
gtcaagaggacaatcactcaaaaagtcttacagaagttagatgtgttttga

DBGET integrated database retrieval system