KEGG   Homo sapiens (human): 1215Help
Entry
1215              CDS       T01001                                 

Gene name
CMA1, CYH, MCT1, chymase
Definition
chymase 1, mast cell (EC:3.4.21.39)
Orthology
K01329  
chymase [EC:3.4.21.39]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    1215 (CMA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     1215 (CMA1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1215 (CMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 247 aa AA seqDB search
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcttcctctccccctgctgctctttctcttgtgctccagagctgaagctggg
gagatcatcgggggcacagaatgcaagccacattcccgcccctacatggcctacctggaa
attgtaacttccaacggtccctcaaaattttgtggtggtttccttataagacggaacttt
gtgctgacggctgctcattgtgcaggaaggtctataacagtcacccttggagcccataac
ataacagaggaagaagacacatggcagaagcttgaggttataaagcaattccgtcatcca
aaatataacacttctactcttcaccacgatatcatgttactaaagttgaaggagaaagcc
agcctgaccctggctgtggggacactccccttcccatcccaattcaactttgtcccacct
gggagaatgtgccgggtggctggctggggaagaacaggtgtgttgaagccgggctcagac
actctgcaagaggtgaagctgagactcatggatccccaggcctgcagccacttcagagac
tttgaccacaatcttcagctgtgtgtgggcaatcccaggaagacaaaatctgcatttaag
ggagactctgggggccctcttctgtgtgctggggtggcccagggcatcgtatcctatgga
cggtcggatgcaaagccccctgctgtcttcacccgaatctcccattaccggccctggatc
aaccagatcctgcaggcaaattaa

DBGET integrated database retrieval system