KEGG   Homo sapiens (human): 122742Help
Entry
122742            CDS       T01001                                 

Gene name
OR4L1, OR14-28, OR4L2P
Definition
(RefSeq) olfactory receptor family 4 subfamily L member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    122742 (OR4L1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    122742 (OR4L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 122742
NCBI-ProteinID: NP_001004717
HGNC: 15356
Ensembl: ENSG00000176246
Vega: OTTHUMG00000169492
Pharos: Q8NH43(Tdark)
UniProt: Q8NH43
Position
14q11.2
AA seq 312 aa AA seqDB search
MDLKNGSLVTEFILLGFFGRWELQIFFFVTFSLIYGATVMGNILIMVTVTCRSTLHSPLY
FLLGNLSFLDMCLSTATTPKMIIDLLTDHKTISVWGCVTQMFFMHFFGGAEMTLLIIMAF
DRYVAICKPLHYRTIMSHKLLKGFAILSWIIGFLHSISQIVLTMNLPFCGHNVINNIFCD
LPLVIKLACIETYTLELFVIADSGLLSFTCFILLLVSYIVILVSVPKKSSHGLSKALSTL
SAHIIVVTLFFGPCIFIYVWPFSSLASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRK
LRFQYVSSAQNF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaaaaatggatctctagtgaccgagtttattttactaggattttttggacga
tgggaacttcaaattttcttctttgtgacattttccctgatctacggtgctactgtgatg
ggaaacattctcattatggtcacagtgacatgtaggtcaacccttcattctcccttgtac
tttctccttggaaatctctcttttttggacatgtgtctctccactgccacaacacccaag
atgatcatagatttgctcactgaccacaagaccatctctgtgtggggctgcgtgacccag
atgttcttcatgcacttctttgggggtgctgagatgactcttctgataatcatggccttt
gacaggtatgtagccatatgtaaacccctgcactataggacaatcatgagccacaagctg
ctaaaggggtttgcgatactttcatggataattggttttttacactccataagccagata
gttttaacaatgaacttgcctttctgtggccacaatgtcataaacaacatattttgtgat
cttccccttgtgatcaagcttgcttgcattgaaacatacaccctggaattatttgtcatt
gctgacagcgggctgctctctttcacctgtttcatcctcttgcttgtttcttacattgtc
atcctggtcagtgtaccaaaaaaatcatcacatgggctctccaaggcgctgtccacattg
tctgcccacatcattgtggtcactctgttctttggaccttgtatttttatctatgtttgg
ccattcagtagtttggcaagcaataaaactcttgccgtattttatacagttatcacaccc
ttactgaatccgagtatttataccctgagaaataagaaaatgcaagaggccataagaaaa
ttacggttccaatatgttagttctgcacagaatttctag

DBGET integrated database retrieval system