KEGG   Homo sapiens (human): 122748Help
Entry
122748            CDS       T01001                                 

Gene name
OR11H6
Definition
(RefSeq) olfactory receptor family 11 subfamily H member 6
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    122748 (OR11H6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    122748 (OR11H6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 122748
NCBI-ProteinID: NP_001004480
HGNC: 15349
Ensembl: ENSG00000176219
Vega: OTTHUMG00000170850
Pharos: Q8NGC7(Tdark)
UniProt: Q8NGC7 A0A126GVP4
Position
14q11.2
AA seq 330 aa AA seqDB search
MFFIIHSLVTSVFLTALGPQNRTMHFVTEFVLLGFHGQREMQSCFFSFILVLYLLTLLGN
GAIVCAVKLDRRLHTPMYILLGNFAFLEIWYISSTVPNMLVNILSEIKTISFSGCFLQFY
FFFSLGTTECFFLSVMAYDRYLAICRPLHYPSIMTGKFCIILVCVCWVGGFLCYPVPIVL
ISQLPFCGPNIIDHLVCDPGPLFALACISAPSTELICYTFNSMIIFGPFLSILGSYTLVI
RAVLCIPSGAGRTKAFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPAGMQKIITLVYTAMT
PFLNPLIYSLRNKDMKDALKRVLGLTVSQN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttctttattattcattctttggttacttctgtttttctaacagctttgggaccccag
aacagaacaatgcattttgtgactgagtttgtcctcctgggtttccatggtcaaagggag
atgcagagctgcttcttctcattcatcctggttctctatctcctgacactgctagggaat
ggagctattgtctgtgcagtgaaattggacaggcggctccacacacccatgtacatcctt
ctgggaaactttgcctttctagagatctggtacatttcctccactgtcccaaacatgcta
gtcaatatcctctctgagattaaaaccatctccttctctggttgcttcctgcaattctat
ttctttttttcactgggtacaacagagtgtttctttttatcagttatggcttatgatcgg
tacctggccatctgtcgtccattacactacccctccatcatgactgggaagttctgtata
attctggtctgtgtatgctgggtaggcggatttctctgctatccagtccctattgttctt
atctcccaacttcccttctgtgggcccaacatcattgaccacttggtgtgtgacccaggc
ccattgtttgcactggcctgcatctctgctccttccactgagcttatctgttacaccttc
aactcgatgattatctttgggcccttcctctccatcttgggatcttacactctggtcatc
agagctgtgctttgtattccctctggtgctggtcgaactaaagctttctccacatgtggg
tcccacctaatggtggtgtctctattctatggaacccttatggtgatgtatgtgagccca
acatcagggaacccagcaggaatgcagaagatcatcactctggtatacacagcaatgact
ccattcttaaatccccttatctatagtcttcgaaacaaagacatgaaagatgctctaaag
agagtcctggggttaacagttagccaaaactga

DBGET integrated database retrieval system