KEGG   Homo sapiens (human): 122809Help
Entry
122809            CDS       T01001                                 

Gene name
SOCS4, SOCS7
Definition
suppressor of cytokine signaling 4
Orthology
K04697  
suppressor of cytokine signaling 4
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Module
ECS complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    122809 (SOCS4)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    122809 (SOCS4)
   04917 Prolactin signaling pathway
    122809 (SOCS4)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    122809 (SOCS4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECS complex
    target recognizing subunit (SOCS box)
     122809 (SOCS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q22.1
AA seq 440 aa AA seqDB search
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgagacagtgaatggtatagagaaaaccgaagtg
tctttaaggaaccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatcgatttttaggccgatctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccgtctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaacgaagaaat
atggaagaaaatataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaaggtcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggatttggatgatgaaatcctgcagttggaaaca
cctcctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaacccatgttactggggagtgatggataaatacgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgacccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagcgcctgtatgttctttgaaccacttctatccactccc
ttaattcggactttccctttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttatgatggcatcgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgc
tag

DBGET integrated database retrieval system