KEGG   Homo sapiens (human): 123099Help
Entry
123099            CDS       T01001                                 

Gene name
DEGS2, C14orf66, DES2, FADS8
Definition
delta(4)-desaturase, sphingolipid 2
Orthology
K04712  
sphingolipid delta-4 desaturase [EC:1.14.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
14q32.2
AA seq 323 aa AA seqDB search
MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWL
VRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPY
AASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPK
AVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGH
ETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDF
VFEDSLGPYARVKRVYRLAKDGL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacagcgcgagccgcagcgacttcgagtgggtctacaccgaccagccgcacacg
cagcggcgcaaggagatactggccaagtacccggccatcaaggccctgatgcggccagac
ccgcgcctcaagtgggcggtgctggtgctggtgctggtgcagatgctggcctgctggctg
gtgcgcgggctggcctggcgctggctgctgttctgggcctacgcctttggtggctgcgtg
aaccactcgctgacgctggccatccacgacatctcgcacaacgcggccttcggcacgggc
cgtgcggcacgcaaccgctggctggccgtgttcgccaacctgcccgtgggtgtgccctac
gccgcctccttcaagaagtaccacgtggaccaccaccgctacctgggcggcgacgggctg
gacgtggacgtgcccacgcgtctggagggctggttcttctgcacacccgcccgcaagctg
ctctggctggtgctgcagcccttcttctactcactacggccgctctgcgtccaccccaag
gccgtgacccgcatggaggtgctcaacacgctggtgcagctggcggccgacctggccatc
tttgccctttgggggctcaagcccgtggtctacctgctggccagctccttcctgggcctg
ggcctgcaccccatctcgggccacttcgtggccgagcactacatgttcctcaagggccac
gagacctactcctactatgggcctctcaactggatcaccttcaatgtgggctaccacgtg
gagcaccacgacttccccagcatcccgggctacaacctgccgctggtgcggaagatcgcg
cccgagtactacgaccacctgccgcagcaccactcctgggtgaaggtgctctgggatttt
gtgtttgaggactccctggggccctatgccagggtgaagcgggtgtacaggctggcaaaa
gatggtctgtga

DBGET integrated database retrieval system