KEGG   Homo sapiens (human): 123099Help
Entry
123099            CDS       T01001                                 

Gene name
DEGS2, C14orf66, DES2, FADS8
Definition
(RefSeq) delta 4-desaturase, sphingolipid 2
  KO
K04712  
sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    123099 (DEGS2)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    123099 (DEGS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     123099 (DEGS2)
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     123099 (DEGS2)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Sphingolipid
   123099 (DEGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6QHC5(Tbio)
UniProt: 
Position
14q32.2
AA seq 323 aa AA seqDB search
MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWL
VRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPY
AASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPK
AVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGH
ETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDF
VFEDSLGPYARVKRVYRLAKDGL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacagcgcgagccgcagcgacttcgagtgggtctacaccgaccagccgcacacg
cagcggcgcaaggagatactggccaagtacccggccatcaaggccctgatgcggccagac
ccgcgcctcaagtgggcggtgctggtgctggtgctggtgcagatgctggcctgctggctg
gtgcgcgggctggcctggcgctggctgctgttctgggcctacgcctttggtggctgcgtg
aaccactcgctgacgctggccatccacgacatctcgcacaacgcggccttcggcacgggc
cgtgcggcacgcaaccgctggctggccgtgttcgccaacctgcccgtgggtgtgccctac
gccgcctccttcaagaagtaccacgtggaccaccaccgctacctgggcggcgacgggctg
gacgtggacgtgcccacgcgtctggagggctggttcttctgcacacccgcccgcaagctg
ctctggctggtgctgcagcccttcttctactcactacggccgctctgcgtccaccccaag
gccgtgacccgcatggaggtgctcaacacgctggtgcagctggcggccgacctggccatc
tttgccctttgggggctcaagcccgtggtctacctgctggccagctccttcctgggcctg
ggcctgcaccccatctcgggccacttcgtggccgagcactacatgttcctcaagggccac
gagacctactcctactatgggcctctcaactggatcaccttcaatgtgggctaccacgtg
gagcaccacgacttccccagcatcccgggctacaacctgccgctggtgcggaagatcgcg
cccgagtactacgaccacctgccgcagcaccactcctgggtgaaggtgctctgggatttt
gtgtttgaggactccctggggccctatgccagggtgaagcgggtgtacaggctggcaaaa
gatggtctgtga

DBGET integrated database retrieval system