KEGG   Homo sapiens (human): 123264Help
Entry
123264            CDS       T01001                                 

Gene name
SLC51B, OSTB, OSTBETA
Definition
solute carrier family 51, beta subunit
Orthology
K14361  
organic solute transporter subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    123264 (SLC51B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.31
AA seq 128 aa AA seqDB search
MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQ
ASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFL
PDVPETES
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggagcacagtgagggggctcccggagacccagccggtactgtggtaccccaggagctg
ctggaagagatgctttggttttttcgtgtggaagatgcatctccctggaatcattccatc
cttgccctggcagctgtggtggtcattataagcatggtcctcctgggaagaagcatccag
gcaagcagaaaagaaaagatgcagccaccagaaaaagaaactccagaagtcctgcatttg
gatgaggccaaggatcacaacagcctaaacaacctaagagaaactttgctctcagaaaag
ccaaacttggcccaggtggaacttgagttaaaagagagagatgtgctgtcagttttcctt
ccggatgtaccagaaactgagagctag

DBGET integrated database retrieval system