KEGG   Homo sapiens (human): 123745Help
Entry
123745            CDS       T01001                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    123745 (PLA2G4E)
   00565 Ether lipid metabolism
    123745 (PLA2G4E)
   00590 Arachidonic acid metabolism
    123745 (PLA2G4E)
   00591 Linoleic acid metabolism
    123745 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    123745 (PLA2G4E)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    123745 (PLA2G4E)
   04010 MAPK signaling pathway
    123745 (PLA2G4E)
   04370 VEGF signaling pathway
    123745 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    123745 (PLA2G4E)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    123745 (PLA2G4E)
 Organismal Systems
  Immune system
   04611 Platelet activation
    123745 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    123745 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    123745 (PLA2G4E)
  Endocrine system
   04912 GnRH signaling pathway
    123745 (PLA2G4E)
   04913 Ovarian Steroidogenesis
    123745 (PLA2G4E)
   04921 Oxytocin signaling pathway
    123745 (PLA2G4E)
  Circulatory system
   04270 Vascular smooth muscle contraction
    123745 (PLA2G4E)
  Nervous system
   04724 Glutamatergic synapse
    123745 (PLA2G4E)
   04726 Serotonergic synapse
    123745 (PLA2G4E)
   04730 Long-term depression
    123745 (PLA2G4E)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    123745 (PLA2G4E)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    123745 (PLA2G4E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     123745 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 123745
NCBI-ProteinID: NP_001193599
HGNC: 24791
Ensembl: ENSG00000188089
Vega: OTTHUMG00000130371
Pharos: Q3MJ16(Tdark)
UniProt: Q3MJ16
Position
15q15.1
AA seq 868 aa AA seqDB search
MSLQASEGCPGLGTNVFVPQSPQTDEEGSRSGRSFSEFEDTQDLDTPGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCRSRKKGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtcctggcctgggaactaatgtgtttgtcccacag
agcccacaaacggatgaagaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcctggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgagggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
agcttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgaatcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgccgctctcgcaagaagggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcggctgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaaggtcgtggtggccaaggccctgaagcaggtgctg
cagctggaggaagacctgcaggaggacgaggtgccgctgatagccatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcaccggtctatcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggctcgg
agacatgtggtaaaggacaagctaccctccctgttcccagaccagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccctccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccgatcctgcctgaaatcccc
aaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctagatggtttcccaaaccagctgaccgagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacctgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaatgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtgact
ttcttcccactcatcaatgacactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacatacacagaggccacctttgacaagctggtgaaactctcagagtataac
atcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

DBGET integrated database retrieval system