KEGG   Homo sapiens (human): 124Help
Entry
124               CDS       T01001                                 

Gene name
ADH1A, ADH1
Definition
alcohol dehydrogenase 1A (class I), alpha polypeptide (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Drug target
Fomepizole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    124 (ADH1A)
  Lipid metabolism
   00071 Fatty acid degradation
    124 (ADH1A)
  Amino acid metabolism
   00350 Tyrosine metabolism
    124 (ADH1A)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    124 (ADH1A)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    124 (ADH1A)
   00982 Drug metabolism - cytochrome P450
    124 (ADH1A)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    124 (ADH1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     124 (ADH1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q23
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNP
QGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTILMF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtggaggttgcacctcctaaggcccatgaagttcgtattaag
atggtggctgtaggaatctgtggcacagatgaccacgtggttagtggtaccatggtgacc
ccacttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccactcgctattcctcagtgtggaaaa
tgcagaatttgtaaaaacccggagagcaactactgcttgaaaaacgatgtaagcaatcct
caggggaccctgcaggatggcaccagcaggttcacctgcaggaggaagcccatccaccac
ttccttggcatcagcaccttctcacagtacacagtggtggatgaaaatgcagtagccaaa
attgatgcagcctcgcctctagagaaagtctgtctcattggctgtggattttcaactggt
tatgggtctgcagtcaatgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctattatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcatttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcatcgtaggggtacctcctgattcccaa
aacctctcaatgaaccctatgctgctactgactggacgtacctggaagggagctattctt
ggtggctttaaaagtaaagaatgtgtcccaaaacttgtggctgattttatggctaagaag
ttttcattggatgcattaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccattctgatgttttga

DBGET integrated database retrieval system