KEGG   Homo sapiens (human): 1240Help
Entry
1240              CDS       T01001                                 

Gene name
CMKLR1, CHEMERINR, ChemR23, DEZ, RVER1
Definition
(RefSeq) chemerin chemokine-like receptor 1
  KO
K04245  chemokine-like receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    1240 (CMKLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 1240
NCBI-ProteinID: NP_001135815
OMIM: 602351
HGNC: 2121
Ensembl: ENSG00000174600
Vega: OTTHUMG00000169576
Pharos: Q99788(Tchem)
UniProt: Q99788
Position
12q23.3
AA seq 373 aa AA seqDB search
MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGL
VIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLI
HNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDT
ANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACY
LTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMN
ERTSMNERETGML
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggaggatgaagattacaacacttccatcagttacggtgatgaataccctgat
tatttagactccattgtggttttggaggacttatcccccttggaagccagggtgaccagg
atcttcctggtggtggtctacagcatcgtctgcttcctcgggattctgggcaatggtctg
gtgatcatcattgccaccttcaagatgaagaagacagtgaacatggtctggttcctcaac
ctggcagtggcagatttcctgttcaacgtcttcctcccaatccatatcacctatgccgcc
atggactaccactgggttttcgggacagccatgtgcaagatcagcaacttccttctcatc
cacaacatgttcaccagcgtcttcctgctgaccatcatcagctctgaccgctgcatctct
gtgctcctccctgtctggtcccagaaccaccgcagcgttcgcctggcttacatggcctgc
atggtcatctgggtcctggctttcttcttgagttccccatctctcgtcttccgggacaca
gccaacctgcatgggaaaatatcctgcttcaacaacttcagcctgtccacacctgggtct
tcctcgtggcccactcactcccaaatggaccctgtggggtatagccggcacatggtggtg
actgtcacccgcttcctctgtggcttcctggtcccagtcctcatcatcacagcttgctac
ctcaccatcgtgtgcaaactgcagcgcaaccgcctggccaagaccaagaagcccttcaag
attattgtgaccatcatcattaccttcttcctctgctggtgcccctaccacacactcaac
ctcctagagctccaccacactgccatgcctggctctgtcttcagcctgggtttgcccctg
gccactgcccttgccattgccaacagctgcatgaaccccattctgtatgttttcatgggt
caggacttcaagaagttcaaggtggccctcttctctcgcctggtcaatgctctaagtgaa
gatacaggccactcttcctaccccagccatagaagctttaccaagatgtcatcaatgaat
gagaggacttctatgaatgagagggagaccggcatgctttga

DBGET integrated database retrieval system