KEGG   Homo sapiens (human): 1240Help
Entry
1240              CDS       T01001                                 

Gene name
CMKLR1, CHEMERINR, ChemR23, DEZ, RVER1
Definition
(RefSeq) chemerin chemokine-like receptor 1
  KO
K04245  
chemokine-like receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   Chemokine like
    1240 (CMKLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.1
AA seq 373 aa AA seqDB search
MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGL
VIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLI
HNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDT
ANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACY
LTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMN
ERTSMNERETGML
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggaggatgaagattacaacacttccatcagttacggtgatgaataccctgat
tatttagactccattgtggttttggaggacttatcccccttggaagccagggtgaccagg
atcttcctggtggtggtctacagcatcgtctgcttcctcgggattctgggcaatggtctg
gtgatcatcattgccaccttcaagatgaagaagacagtgaacatggtctggttcctcaac
ctggcagtggcagatttcctgttcaacgtcttcctcccaatccatatcacctatgccgcc
atggactaccactgggttttcgggacagccatgtgcaagatcagcaacttccttctcatc
cacaacatgttcaccagcgtcttcctgctgaccatcatcagctctgaccgctgcatctct
gtgctcctccctgtctggtcccagaaccaccgcagcgttcgcctggcttacatggcctgc
atggtcatctgggtcctggctttcttcttgagttccccatctctcgtcttccgggacaca
gccaacctgcatgggaaaatatcctgcttcaacaacttcagcctgtccacacctgggtct
tcctcgtggcccactcactcccaaatggaccctgtggggtatagccggcacatggtggtg
actgtcacccgcttcctctgtggcttcctggtcccagtcctcatcatcacagcttgctac
ctcaccatcgtgtgcaaactgcagcgcaaccgcctggccaagaccaagaagcccttcaag
attattgtgaccatcatcattaccttcttcctctgctggtgcccctaccacacactcaac
ctcctagagctccaccacactgccatgcctggctctgtcttcagcctgggtttgcccctg
gccactgcccttgccattgccaacagctgcatgaaccccattctgtatgttttcatgggt
caggacttcaagaagttcaaggtggccctcttctctcgcctggtcaatgctctaagtgaa
gatacaggccactcttcctaccccagccatagaagctttaccaagatgtcatcaatgaat
gagaggacttctatgaatgagagggagaccggcatgctttga

DBGET integrated database retrieval system