KEGG   Homo sapiens (human): 1241Help
Entry
1241              CDS       T01001                                 

Gene name
LTB4R, BLT1, BLTR, CMKRL1, GPR16, LTB4R1, LTBR1, P2RY7, P2Y7
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  
leukotriene B4 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1241 (LTB4R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Leukotriene
    1241 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2-q12
AA seq 352 aa AA seqDB search
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacactacatcttctgcagcacccccctcactaggtgtagagttcatctctctgctg
gctatcatcctgctgtcagtggcgctggctgtggggcttcccggcaacagctttgtggtg
tggagtatcctgaaaaggatgcagaagcgctctgtcactgccctgatggtgctgaacctg
gccctggccgacctggccgtattgctcactgctccctttttccttcacttcctggcccaa
ggcacctggagttttggactggctggttgccgcctgtgtcactatgtctgcggagtcagc
atgtacgccagcgtcctgcttatcacggccatgagtctagaccgctcactggcggtggcc
cgcccctttgtgtcccagaagctacgcaccaaggcgatggcccggcgggtgctggcaggc
atctgggtgttgtcctttctgctggccacacccgtcctcgcgtaccgcacagtagtgccc
tggaaaacgaacatgagcctgtgcttcccgcggtaccccagcgaagggcaccgggccttc
catctaatcttcgaggctgtcacgggcttcctgctgcccttcctggctgtggtggccagc
tactcggacatagggcgtcggctacaggcccggcgcttccgccgcagccgccgcaccggc
cgcctggtggtgctcatcatcctgaccttcgccgccttctggctgccctaccacgtggtg
aacctggctgaggcgggccgcgcgctggccggccaggccgccgggttagggctcgtgggg
aagcggctgagcctggcccgcaacgtgctcatcgcactcgccttcctgagcagcagcgtg
aaccccgtgctgtacgcgtgcgccggcggcggcctgctgcgctcggcgggcgtgggcttc
gtcgccaagctgctggagggcacgggctccgaggcgtccagcacgcgccgcgggggcagc
ctgggccagaccgctaggagcggccccgccgctctggagcccggcccttccgagagcctc
actgcctccagccctctcaagttaaacgaactgaactag

DBGET integrated database retrieval system